"PTH" Related Products

Expand
Expand
Expand

Recombinant Human PTH therapeutic protein

Cat.No. : PTH-P062H
Product Overview : Recombinant human parathyroid hormone is a potent anabolic agent used in the treatment of osteoporosis.
Description : Our expression product is the active ingredient of Apthela, Forsteo, Forteo, Fortessa, Opthia, Optia, Optiah, Zalectra and Zelletra.
Species : Human
Molecular Mass : 4.12 Kda
Protein length : 34 Aa
AA Sequence : SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Endotoxin : < 1.0 EU per μg of the protein
Purity : >95%
Storage : Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
Gene Name : PTH parathyroid hormone [ Homo sapiens ]
Official Symbol : PTH
Synonyms : PTH; parathyroid hormone; parathormone; parathyrin; parathyroid hormone 1; PTH1;
Gene ID : 5741
mRNA Refseq : NM_000315
Protein Refseq : NP_000306
MIM : 168450
UniProt ID : P01270
Chromosome Location : 11p15.3-p15.1
Pathway : Class B/2 (Secretin family receptors), organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Osteoblast Signaling, organism-specific biosystem; Signal Transduction, organism-specific biosystem;
Function : hormone activity; parathyroid hormone receptor binding; peptide hormone receptor binding; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.