Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human PTH therapeutic protein

Cat.No. : PTH-P062H
Product Overview : Recombinant human parathyroid hormone is a potent anabolic agent used in the treatment of osteoporosis.
  • Specification
  • Gene Information
  • Related Products
Description : Our expression product is the active ingredient of Apthela, Forsteo, Forteo, Fortessa, Opthia, Optia, Optiah, Zalectra and Zelletra.
Species : Human
Molecular Mass : 4.12 Kda
Protein length : 34 Aa
AA Sequence : SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Endotoxin : < 1.0 EU per μg of the protein
Purity : >95%
Storage : Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
Gene Name : PTH parathyroid hormone [ Homo sapiens ]
Official Symbol : PTH
Synonyms : PTH; parathyroid hormone; parathormone; parathyrin; parathyroid hormone 1; PTH1;
Gene ID : 5741
mRNA Refseq : NM_000315
Protein Refseq : NP_000306
MIM : 168450
UniProt ID : P01270
Chromosome Location : 11p15.3-p15.1
Pathway : Class B/2 (Secretin family receptors), organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Osteoblast Signaling, organism-specific biosystem; Signal Transduction, organism-specific biosystem;
Function : hormone activity; parathyroid hormone receptor binding; peptide hormone receptor binding; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (3)

Write a review
Reviews
07/16/2023

    The PTH protein received was of stable composition and high concentration, giving me satisfactory experimental results.

    01/26/2022

      The technical staff often communicate with me to understand the progress of my experiments and give timely responses to problems encountered in the experiments.

      12/22/2020

        The company provides one-stop service, from product purchase to product delivery, it was very smooth.

        Ask a Question for All PTH Products

        Required fields are marked with *

        My Review for All PTH Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends