Recombinant Human PTH protein(41-110 aa), C-His-tagged
Cat.No. : | PTH-2516H |
Product Overview : | Recombinant Human PTH protein(P01270)(41-110 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 41-110 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 10.5 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | NLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLT |
Gene Name | PTH parathyroid hormone [ Homo sapiens ] |
Official Symbol | PTH |
Synonyms | PTH; parathyroid hormone; parathormone; parathyrin; parathyroid hormone 1; PTH1; |
Gene ID | 5741 |
mRNA Refseq | NM_000315 |
Protein Refseq | NP_000306 |
MIM | 168450 |
UniProt ID | P01270 |
◆ Recombinant Proteins | ||
pth-4157E | Recombinant Escherichia coli pth protein, His-tagged | +Inquiry |
PTH-5055P | Recombinant Pig PTH protein, His-tagged | +Inquiry |
PTH-320H | Recombinant Human PTH | +Inquiry |
Pth-569R | Recombinant Rat Pth protein, His & MBP-tagged | +Inquiry |
PTH-01H | Recombinant Human PTH protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTH-1273HCL | Recombinant Human PTH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTH Products
Required fields are marked with *
My Review for All PTH Products
Required fields are marked with *