Recombinant Human PTH protein(41-110 aa), C-His-tagged

• Cat.No.: PTH-2516H
• Product Overview: Recombinant Human PTH protein(P01270)(41-110 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 41-110 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 10.5 kDa
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: NLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLT

Gene Information

• Gene Name: PTH parathyroid hormone [ Homo sapiens ]
• Official Symbol: PTH
• Synonyms: PTH; parathyroid hormone; parathormone; parathyrin; parathyroid hormone 1; PTH1
• Gene ID: 5741
• mRNA Refseq: NM_000315
• Protein Refseq: NP_000306
• MIM: 168450
• UniProt ID: P01270