Recombinant Human PTH protein(41-110 aa), C-His-tagged

Cat.No. : PTH-2516H
Product Overview : Recombinant Human PTH protein(P01270)(41-110 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 41-110 aa
Form : 0.15 M Phosphate buffered saline
Molecular Mass : 10.5 kDa
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : NLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLT
Gene Name PTH parathyroid hormone [ Homo sapiens ]
Official Symbol PTH
Synonyms PTH; parathyroid hormone; parathormone; parathyrin; parathyroid hormone 1; PTH1;
Gene ID 5741
mRNA Refseq NM_000315
Protein Refseq NP_000306
MIM 168450
UniProt ID P01270

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PTH Products

Required fields are marked with *

My Review for All PTH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon