Recombinant Human PTH protein(41-110 aa), C-His-tagged
| Cat.No. : | PTH-2516H | 
| Product Overview : | Recombinant Human PTH protein(P01270)(41-110 aa), fused with C-terminal His tag, was expressed in E. coli. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 41-110 aa | 
| Form : | 0.15 M Phosphate buffered saline | 
| Molecular Mass : | 10.5 kDa | 
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C.  | 
                                
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. | 
| AA Sequence : | NLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLT | 
| Gene Name | PTH parathyroid hormone [ Homo sapiens ] | 
| Official Symbol | PTH | 
| Synonyms | PTH; parathyroid hormone; parathormone; parathyrin; parathyroid hormone 1; PTH1; | 
| Gene ID | 5741 | 
| mRNA Refseq | NM_000315 | 
| Protein Refseq | NP_000306 | 
| MIM | 168450 | 
| UniProt ID | P01270 | 
| ◆ Recombinant Proteins | ||
| pth-4157E | Recombinant Escherichia coli pth protein, His-tagged | +Inquiry | 
| PTH-5055P | Recombinant Pig PTH protein, His-tagged | +Inquiry | 
| PTH-320H | Recombinant Human PTH | +Inquiry | 
| Pth-569R | Recombinant Rat Pth protein, His & MBP-tagged | +Inquiry | 
| PTH-01H | Recombinant Human PTH protein | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| PTH-1273HCL | Recombinant Human PTH cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All PTH Products
Required fields are marked with *
My Review for All PTH Products
Required fields are marked with *
  
        
    
      
            