"IL11" Related Products

Expand
Expand

Recombinant Human IL11 therapeutic protein

Cat.No.: IL11-P012H
Product Overview: Recombinant Interleukin eleven, which is produced in Escherichia coli (E. coli) by recombinant DNA technology, has a molecular mass of approximately 19,000 daltons, and is non-glycosylated. The polypeptide is 177 amino acids in length (the natural IL-11 has 178). This alteration has not resulted in measurable differences in bioactivity either in vitro or in vivo.
Description: The protein encoded by this gene is a member of the gp130 family of cytokines. These cytokines drive the assembly of multisubunit receptor complexes, all of which contain at least one molecule of the transmembrane signaling receptor IL6ST (gp130). This cytokine is shown to stimulate the T-cell-dependent development of immunoglobulin-producing B cells. It is also found to support the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells. The expression product is the active ingredient of Neumega.
Source: E. coli
Species: Human
Molecular Mass: 19kDa
Protein length: 177aa
AA Sequence: GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGV LTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPP SSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Purity: >95%
Gene Name: IL11 interleukin 11 [ Homo sapiens ]
Official Symbol: IL11
Synonyms: IL11; interleukin 11; interleukin-11; adipogenesis inhibitory factor; AGIF; IL 11; oprelvekin; IL-11;
Gene ID: 3589
mRNA Refseq: NM_000641
Protein Refseq: NP_000632
MIM: 147681
UniProt ID: P20809
Chromosome Location: 19q13.3-q13.4
Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; Rheumatoid arthritis, organism-specific biosystem;
Function: cytokine activity; growth factor activity; interleukin-11 receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.