Recombinant Human IL11 therapeutic protein(Oprelvekin)

Cat.No. : IL11-P012H
Product Overview : Recombinant Interleukin eleven, which is produced in Escherichia coli (E. coli) by recombinant DNA technology, has a molecular mass of approximately 19,000 daltons, and is non-glycosylated. The polypeptide is 177 amino acids in length (the natural IL-11 has 178). This alteration has not resulted in measurable differences in bioactivity either in vitro or in vivo.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 177aa
Description : The protein encoded by this gene is a member of the gp130 family of cytokines. These cytokines drive the assembly of multisubunit receptor complexes, all of which contain at least one molecule of the transmembrane signaling receptor IL6ST (gp130). This cytokine is shown to stimulate the T-cell-dependent development of immunoglobulin-producing B cells. It is also found to support the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells. The expression product is the active ingredient of Neumega.
Molecular Mass : 19kDa
AA Sequence : GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGV LTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPP SSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Purity : >95%
Alias : IL11; AGIF; IL 11; IL-11; Oprelvekin
Gene Name IL11 interleukin 11 [ Homo sapiens ]
Official Symbol IL11
Synonyms IL11; interleukin 11; interleukin-11; adipogenesis inhibitory factor; AGIF; IL 11; oprelvekin; IL-11;
Gene ID 3589
mRNA Refseq NM_000641
Protein Refseq NP_000632
MIM 147681
UniProt ID P20809
Chromosome Location 19q13.3-q13.4
Pathway Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; Rheumatoid arthritis, organism-specific biosystem;
Function cytokine activity; growth factor activity; interleukin-11 receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL11 Products

Required fields are marked with *

My Review for All IL11 Products

Required fields are marked with *

0
cart-icon
0
compare icon