"IDUA" Related Products

Expand
Expand

Recombinant Human IDUA therapeutic protein

Cat.No.: IDUA-P025H
Product Overview: Recombinant Human alpha-L-iduronidase, 628 residues (mature form), produced by recombinant DNA technology in a Chinese hamster ovary cell line. Laronidase is a glycoprotein with a molecular weight of approximately 83 kD. The predicted amino acid sequence of the recombinant form, as well as the nucleotide sequence that encodes it, are identical to a polymorphic form of human a-L-iduronidase. It contains 6 N-linked oligosaccharide modification sites.
Description: This gene encodes an enzyme that hydrolyzes the terminal alpha-L-iduronic acid residues of two glycosaminoglycans, dermatan sulfate and heparan sulfate. This hydrolysis is required for the lysosomal degradation of these glycosaminoglycans. Mutations in this gene that result in enzymatic deficiency lead to the autosomal recessive disease mucopolysaccharidosis type I (MPS I). The expression product is the active ingredient of Aldurazyme.
Source: CHO
Species: Human
Molecular Mass: 69.9 kDa
AA Sequence: APHLVQVDAARALWPLRRFWRSTGFCPPLPHSQADQYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVT TRGSTGRGLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGL AHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRH CHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQP WRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLL RKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAH PNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPA GGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKA YTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLEVPVPRGPPSPGNP
Endotoxin: < 1.0 EU per μg of the protein
Purity: >95%
Storage: Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
Gene Name: IDUA iduronidase, alpha-L- [ Homo sapiens ]
Official Symbol: IDUA
Synonyms: IDUA; iduronidase, alpha-L-; alpha-L-iduronidase; MPS1; IDA;
Gene ID: 3425
mRNA Refseq: NM_000203
Protein Refseq: NP_000194
MIM: 252800
UniProt ID: P35475
Chromosome Location: 4p16.3
Pathway: Dermatan sulfate degradation, organism-specific biosystem; Dermatan sulfate degradation, conserved biosystem; Glycosaminoglycan degradation, organism-specific biosystem; Glycosaminoglycan degradation, conserved biosystem; Heparan sulfate degradation, organism-specific biosystem; Heparan sulfate degradation, conserved biosystem; Lysosome, organism-specific biosystem;
Function: L-iduronidase activity; cation binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.