"Hirudin" Related Products

Recombinant Leech Hirudin therapeutic protein

Cat.No.: Hirudin-P030L
Product Overview: Lepirudin is identical to natural hirudin except for substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. It is produced via yeast cells.
Description: The expression product is the active ingredient of Refludan.
Source: Yeast
Species: Leech
Molecular Mass: 6963.4 Da
Protein length: 65 Aa
AA Sequence: LVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ
Endotoxin: < 1.0 EU per μg of the protein
Purity: >95%
Storage: Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.