Recombinant Leech Hirudin therapeutic protein(Lepirudin)

Cat.No. : Hirudin-P030L
Product Overview : Lepirudin is identical to natural hirudin except for substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. It is produced via yeast cells.
Availability May 25, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Leech
Source : Yeast
Tag : Non
Protein Length : 65 Aa
Description : The expression product is the active ingredient of Refludan.
Molecular Mass : 6963.4 Da
AA Sequence : LVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ
Endotoxin : < 1.0 EU per μg of the protein
Purity : >95%
Storage : Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
Alias : Hirudin; Lepirudin
Publications :
Generation of a Universal Human Complement Source by Large-Scale Depletion of IgG and IgM from Pooled Human Plasma (2021)

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Hirudin Products

Required fields are marked with *

My Review for All Hirudin Products

Required fields are marked with *

0

Inquiry Basket

cartIcon