Recombinant Leech Hirudin therapeutic protein(Lepirudin)

• Cat.No.: Hirudin-P030L
• Product Overview: Lepirudin is identical to natural hirudin except for substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. It is produced via yeast cells.

Specification

• Species: Leech
• Source: Yeast
• Tag: Non
• Protein Length: 65 Aa
• Description: The expression product is the active ingredient of Refludan.
• Molecular Mass: 6963.4 Da
• AA Sequence: LVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ
• Endotoxin: < 1.0 EU per μg of the protein
• Purity: >95%
• Storage: Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
• Alias: Hirudin; Lepirudin
• Publications:
  Generation of a Universal Human Complement Source by Large-Scale Depletion of IgG and IgM from Pooled Human Plasma (2021)