Recombinant Leech Hirudin therapeutic protein(Lepirudin)
Cat.No. : | Hirudin-P030L |
Product Overview : | Lepirudin is identical to natural hirudin except for substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. It is produced via yeast cells. |
Availability | October 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Leech |
Source : | Yeast |
Tag : | Non |
Protein Length : | 65 Aa |
Description : | The expression product is the active ingredient of Refludan. |
Molecular Mass : | 6963.4 Da |
AA Sequence : | LVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ |
Endotoxin : | < 1.0 EU per μg of the protein |
Purity : | >95% |
Storage : | Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
Alias : | Hirudin; Lepirudin |
Publications : |
Generation of a Universal Human Complement Source by Large-Scale Depletion of IgG and IgM from Pooled Human Plasma (2021)
|
◆ Recombinant Proteins | ||
Hirudin-4247M | Recombinant Medicinal leech Hirudin protein, GST-tagged | +Inquiry |
HIRUD-1239P | Active Recombinant Poecilobdella viridis Hirudin Protein | +Inquiry |
Hirudin-02 | Recombinant Hirudo Hirudin protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Hirudin Products
Required fields are marked with *
My Review for All Hirudin Products
Required fields are marked with *