Recombinant Hirudo Hirudin protein
| Cat.No. : | Hirudin-02 |
| Product Overview : | Recombinant Hirudo Hirudin protein was expressed in Pichia Pastoris. |
| Availability | January 25, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Citation
- Download
| Species : | Hirudo |
| Source : | P.pastoris |
| Tag : | Non |
| Protein Length : | 63 |
| Description : | Hirudin is the most potent natural thrombin-specific protease inhibitor, and is originally derived in the salivary glands of the medicinal leech. Unlike heparin, hirudin act directly on thrombin, rather than through other clotting factors. They have a high binding affinity and specificity for thrombin. Therefore, hirudin prevents or dissolves the formation of clots and thrombi, and has therapeutic value in blood coagulation disorders, in the treatment of skin hematomas and of superficial varicose veins, either as an injectable or a topical application cream. |
| Form : | Lyophilized from a 0.2μm filtered solution of 20 mM PBS, pH 7.0, containing 2 % mannitol. |
| Bio-activity : | The biological activity is determined by chromogenic assay, 1 unit is defined as the amount of Hirudin that neutralizes 1 unit of the WHO preparation 89/588 of thrombin. The specific activity is no less than 14,000 ATU/mg protein. |
| Molecular Mass : | Approximately 6.7 kDa, a single non-glycosylated polypeptide chain containing 63 amino acid residues. |
| AA Sequence : | VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPGPQSHNDGDFEEPEEYL |
| Endotoxin : | Less than 1 EU/μg of rHirudin as determined by LAL method. |
| Purity : | >96% by SDS-PAGE and HPLC analysis. |
| Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
| Publications : |
| UniProt ID | P84590 |
| ◆ Recombinant Proteins | ||
| Hirudin-02 | Recombinant Hirudo Hirudin protein | +Inquiry |
| Hirudin-4247M | Recombinant Medicinal leech Hirudin protein, GST-tagged | +Inquiry |
| HIRUD-1239P | Active Recombinant Poecilobdella viridis Hirudin Protein | +Inquiry |
Thrombin-Activatable Microbubbles as Potential Ultrasound Contrast Agents for the Detection of Acute Thrombosis
Journal: ACS applied materials & interfaces PubMed ID: 28994575 Data: 2017/11/17
Authors: Jacques Lux, Alexander M. Vezeridis, Robert F. Mattrey
Article Snippet:For regular MBs, Definity (Perflutren Lipid Microsphere) was purchased from Lantheus Medical Imaging, Inc. (North Billerica, MA).For regular MBs, Definity (Perflutren Lipid Microsphere) was purchased from Lantheus Medical Imaging, Inc. (North Billerica, MA).. Recombinant Hirudin (16 500 U/mg) was purchased from Creative BioMart Inc. (Shirley, NY).. Other chemicals were purchased from Fisher Scientific and Sigma-Aldrich and used without further purification.Other chemicals were purchased from Fisher Scientific and Sigma-Aldrich and used without further purification.
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Hirudin Products
Required fields are marked with *
My Review for All Hirudin Products
Required fields are marked with *
