Recombinant Human PLOD1 therapeutic protein LH-P015H

Recombinant Human PLOD1 therapeutic protein

PRODUCTS

Home / Products / Recombinant Human PLOD1 therapeutic protein

Recombinant Human PLOD1 therapeutic protein

PLOD1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : LH-P015H
Product Overview : The therapeutic protein is a recombinant human luteinizing hormone produced in yeast with 2 subunits, alpha = 92 residues, beta = 121 residues. It is a heterodimeric glycoprotein. Each monomeric unit is a glycoprotein molecule. In females, an acute rise of LH ("LH surge") triggers ovulation and the development of the corpus luteum. In males, it stimulates Leydig cell production of testosterone. It was the first and only recombinant human form of luteinizing hormone (LH) developed for use in the stimulation of follicular development.
Description : This gene is a member of the LHB family and encodes the beta subunit of luteinizing hormone (LH). LHB is heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. LHB is expressed in the pituitary gland and promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids. The genes for the beta chains of chorionic gonadotropin and for luteinizing hormone are contiguous on chromosome 19q13.3. Mutations in this gene are associated with hypogonadism which is characterized by infertility and pseudohermaphroditism. The expression product is the active ingredient of Luveris.
Source : Yeast
Species : Human
Molecular Mass : 30kDa
AA Sequence : >Alpha ChainAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS>Beta Chain (LH)SREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL
Endotoxin : < 1.0 EU per μg of the protein
Purity : >95%
Storage : Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
Gene Name : PLOD1 procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 [ Homo sapiens ]
Official Symbol : PLOD1
Synonyms : LH; LH1; LLH; EDS6; PLOD
Gene ID : 5351
mRNA Refseq : NM_000302
Protein Refseq : NP_000293
MIM : 153454
UniProt ID : Q02809
Chromosome Location : 1p36.22
Pathway : Extracellular matrix organization, organism-specific biosystem; Collagen formation, organism-specific biosystem; Collagen biosynthesis and modifying enzymes, organism-specific biosystem

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy