"TOP2B" Related Products

Expand
Expand
Expand

Recombinant Human Type II Topoisomerase, His-tagged

Cat.No.: TOP2B-01H
Product Overview: Recombinant hTOP2βcore (residues 445-1201), fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
Source: E.coli
Species: Human
Tag: His
Form: 20 mM Tris-HCl, 200 mM NaCl, pH7.4
Molecular Mass: ~87 kDa
AA Sequence: SVKYSKIKGIPKLDDANDAGGKHSLECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIME NAEINNIIKIVGLQYKKSYDDAESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIV KASKNKQELSFYSIPEFDEWKKHIENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFRYAGPEDDAAITLAF SKKKIDDRKEWLTNFMEDRRQRRLHGLPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGFKPGQRK VLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAASP RYIFTMLSTLARLLFPAVDDNLLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRR MLDGLDPHPMLPNYKNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNGTDKTPAL ISDYKEYHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMVLFDHMGCLKKYETVQDILKEFFDLRLS YYGLRKEWLVGMLGAESTKLNNQARFILEKIQGKITIENRSKKDLIQMLVQRGYESDPVKAWKEAQEKAAEEDET QNQHDDSSSDSGTPSGPDFNYILNMSLWSLTKEKVEELIKQRDAKGREVNDLKRKSPSDLWKEDLAAFVEELDKV ESQERED
Purity: >92% as determined by SDS-PAGE
Storage: Short Term Storage at +4°C. Long Term Storage at -20°C to -80°C. Avoid freeze/thaw cycles.
Gene Name: TOP2B topoisomerase (DNA) II beta 180kDa [ Homo sapiens ]
Official Symbol: TOP2B
Synonyms: TOP2B; topoisomerase (DNA) II beta 180kDa; topoisomerase (DNA) II beta (180kD); DNA topoisomerase 2-beta; topo II beta; antigen MLAA-44; topoisomerase IIb; topoisomerase II beta; U937 associated antigen; DNA topoisomerase II beta; DNA topoisomerase II, 180 kD; DNA topoisomerase II, beta isozyme; TOPIIB; top2beta;
Gene ID: 7155
mRNA Refseq: NM_001068
Protein Refseq: NP_001059
MIM: 126431
UniProt ID: Q02880
Chromosome Location: 3p24
Function: ATP binding; DNA topoisomerase (ATP-hydrolyzing) activity; DNA-dependent ATPase activity; chromatin binding; enzyme binding; histone deacetylase binding; isomerase activity; nucleotide binding; protein C-terminus binding; protein heterodimerization activity; protein kinase C binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.