Recombinant Human Type II Topoisomerase, His-tagged TOP2B-01H

Recombinant Human Type II Topoisomerase, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human Type II Topoisomerase, His-tagged

Recombinant Human Type II Topoisomerase, His-tagged

TOP2B Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : TOP2B-01H
Product Overview : Recombinant hTOP2βcore (residues 445-1201), fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
Source : E.coli
Species : Human
Tag : His
Form : 20 mM Tris-HCl, 200 mM NaCl, pH7.4
Molecular Mass : ~87 kDa
AA Sequence : SVKYSKIKGIPKLDDANDAGGKHSLECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIME NAEINNIIKIVGLQYKKSYDDAESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIV KASKNKQELSFYSIPEFDEWKKHIENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFRYAGPEDDAAITLAF SKKKIDDRKEWLTNFMEDRRQRRLHGLPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGFKPGQRK VLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAASP RYIFTMLSTLARLLFPAVDDNLLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRR MLDGLDPHPMLPNYKNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNGTDKTPAL ISDYKEYHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMVLFDHMGCLKKYETVQDILKEFFDLRLS YYGLRKEWLVGMLGAESTKLNNQARFILEKIQGKITIENRSKKDLIQMLVQRGYESDPVKAWKEAQEKAAEEDET QNQHDDSSSDSGTPSGPDFNYILNMSLWSLTKEKVEELIKQRDAKGREVNDLKRKSPSDLWKEDLAAFVEELDKV ESQERED
Purity : >92% as determined by SDS-PAGE
Storage : Short Term Storage at +4°C. Long Term Storage at -20°C to -80°C. Avoid freeze/thaw cycles.
Gene Name : TOP2B topoisomerase (DNA) II beta 180kDa [ Homo sapiens ]
Official Symbol : TOP2B
Synonyms : TOP2B; topoisomerase (DNA) II beta 180kDa; topoisomerase (DNA) II beta (180kD); DNA topoisomerase 2-beta; topo II beta; antigen MLAA-44; topoisomerase IIb; topoisomerase II beta; U937 associated antigen; DNA topoisomerase II beta; DNA topoisomerase II, 180 kD; DNA topoisomerase II, beta isozyme; TOPIIB; top2beta;
Gene ID : 7155
mRNA Refseq : NM_001068
Protein Refseq : NP_001059
MIM : 126431
UniProt ID : Q02880
Chromosome Location : 3p24
Function : ATP binding; DNA topoisomerase (ATP-hydrolyzing) activity; DNA-dependent ATPase activity; chromatin binding; enzyme binding; histone deacetylase binding; isomerase activity; nucleotide binding; protein C-terminus binding; protein heterodimerization activity; protein kinase C binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy