Recombinant Human PTHLH, His-tagged

• Cat.No.: PTHLH-112H
• Product Overview: Recombinant Human PTHLH(Ala37-Arg175) fussed with 6His tag at C-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 37-175 a.a.
• Description: Parathyroid Hormone-Related protein (PTHRP) is a member of the parathyroid hormone family. PTHRP is known as a potent inhibitor of chondrocyte maturation. PTHRP is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. PTHRP also regulates epithelial-mesenchymal interactions during the formation of the mammary glands. During endochondral bone development, PTHRP plays a major role in suppressing the onset of hypertrophic differentiation. Defects in PTHRP are the cause of Brachydactyly Type E2.
• Form: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4
• AA Sequence: MAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDE GRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDT STTSLELDSRLEHHHHHH
• Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: PTHLH parathyroid hormone-like hormone [ Homo sapiens ]
• Official Symbol: PTHLH
• Synonyms: HHM; PLP; BDE2; PTHR; PTHRP; parathyroid hormone-related protein; PTH-Rp; PTH-related protein; osteostatin; parathyroid hormone-like hormone preproprotein; parathyroid hormone-like related protein
• Gene ID: 5744
• mRNA Refseq: NM_002820
• Protein Refseq: NP_002811
• MIM: 168470
• UniProt ID: P12272
• Chromosome Location: 12p12.1-p11.2
• Pathway: Class B/2 (Secretin family receptors), organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem
• Function: hormone activity; peptide hormone receptor binding