Recombinant Human PTHLH, His-tagged
Cat.No. : | PTHLH-112H |
Product Overview : | Recombinant Human PTHLH(Ala37-Arg175) fussed with 6His tag at C-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 37-175 a.a. |
Description : | Parathyroid Hormone-Related protein (PTHRP) is a member of the parathyroid hormone family. PTHRP is known as a potent inhibitor of chondrocyte maturation. PTHRP is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. PTHRP also regulates epithelial-mesenchymal interactions during the formation of the mammary glands. During endochondral bone development, PTHRP plays a major role in suppressing the onset of hypertrophic differentiation. Defects in PTHRP are the cause of Brachydactyly Type E2. |
Form : | Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 |
AA Sequence : | MAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDE GRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDT STTSLELDSRLEHHHHHH |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | PTHLH parathyroid hormone-like hormone [ Homo sapiens ] |
Official Symbol | PTHLH |
Synonyms | HHM; PLP; BDE2; PTHR; PTHRP; parathyroid hormone-related protein; PTH-Rp; PTH-related protein; osteostatin; parathyroid hormone-like hormone preproprotein; parathyroid hormone-like related protein |
Gene ID | 5744 |
mRNA Refseq | NM_002820 |
Protein Refseq | NP_002811 |
MIM | 168470 |
UniProt ID | P12272 |
Chromosome Location | 12p12.1-p11.2 |
Pathway | Class B/2 (Secretin family receptors), organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem |
Function | hormone activity; peptide hormone receptor binding |
◆ Recombinant Proteins | ||
Pthlh-7768R | Recombinant Rat Pthlh protein, His & S-tagged | +Inquiry |
PTHLH-664H | Recombinant Human PTHLH protein | +Inquiry |
PTHLH-6076H | Recombinant Human PTHLH Protein (Ala37-Arg175), C-His tagged | +Inquiry |
PTHLH-7764C | Recombinant Cattle PTHLH protein, His & S-tagged | +Inquiry |
PTHLH-3943H | Recombinant Human PTHLH Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
PTHLH-322H | Recombinant Human PTHLH Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTHLH-2702HCL | Recombinant Human PTHLH 293 Cell Lysate | +Inquiry |
PTHLH-2703HCL | Recombinant Human PTHLH 293 Cell Lysate | +Inquiry |
PTHLH-2701HCL | Recombinant Human PTHLH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTHLH Products
Required fields are marked with *
My Review for All PTHLH Products
Required fields are marked with *