Recombinant Human PTHLH, His-tagged PTHLH-112H

Recombinant Human PTHLH, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human PTHLH, His-tagged

Recombinant Human PTHLH, His-tagged

PTHLH Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : PTHLH-112H
Product Overview : Recombinant Human PTHLH(Ala37-Arg175) fussed with 6His tag at C-terminal was expressed in E. coli.
Description : Parathyroid Hormone-Related protein (PTHRP) is a member of the parathyroid hormone family. PTHRP is known as a potent inhibitor of chondrocyte maturation. PTHRP is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. PTHRP also regulates epithelial-mesenchymal interactions during the formation of the mammary glands. During endochondral bone development, PTHRP plays a major role in suppressing the onset of hypertrophic differentiation. Defects in PTHRP are the cause of Brachydactyly Type E2.
Source : E. coli
Species : Human
Tag : His
Form : Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4
AA Sequence : MAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDE GRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDT STTSLELDSRLEHHHHHH
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name : PTHLH parathyroid hormone-like hormone [ Homo sapiens ]
Official Symbol : PTHLH
Synonyms : HHM; PLP; BDE2; PTHR; PTHRP; parathyroid hormone-related protein; PTH-Rp; PTH-related protein; osteostatin; parathyroid hormone-like hormone preproprotein; parathyroid hormone-like related protein
Gene ID : 5744
mRNA Refseq : NM_002820
Protein Refseq : NP_002811
MIM : 168470
UniProt ID : P12272
Chromosome Location : 12p12.1-p11.2
Pathway : Class B/2 (Secretin family receptors), organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem
Function : hormone activity; peptide hormone receptor binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy