Recombinant Human PTHLH protein, His-tagged
Cat.No. : | PTHLH-5533H |
Product Overview : | Recombinant Human PTHLH protein(1-175 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-175 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | PTHLH parathyroid hormone-like hormone [ Homo sapiens ] |
Official Symbol | PTHLH |
Synonyms | PTHLH; parathyroid hormone-like hormone; parathyroid hormone-related protein; HHM; osteostatin; PLP; PTHR; PTHRP; PTH-rP; PTH-related protein; parathyroid hormone-like related protein; BDE2; MGC14611; |
Gene ID | 5744 |
mRNA Refseq | NM_002820 |
Protein Refseq | NP_002811 |
UniProt ID | P12272 |
◆ Recombinant Proteins | ||
PTHLH-112H | Recombinant Human PTHLH, His-tagged | +Inquiry |
Pthlh-2830R | Recombinant Rat Pthlh Protein, His-tagged, KLH Conjugated | +Inquiry |
PTHLH-7764C | Recombinant Cattle PTHLH protein, His & S-tagged | +Inquiry |
PTHLH-7765D | Recombinant Dog PTHLH protein, His & S-tagged | +Inquiry |
PTHLH-301482H | Recombinant Human PTHLH protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
PTHLH-322H | Recombinant Human PTHLH Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTHLH-2702HCL | Recombinant Human PTHLH 293 Cell Lysate | +Inquiry |
PTHLH-2703HCL | Recombinant Human PTHLH 293 Cell Lysate | +Inquiry |
PTHLH-2701HCL | Recombinant Human PTHLH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTHLH Products
Required fields are marked with *
My Review for All PTHLH Products
Required fields are marked with *