Active Recombinant Human TNFSF15 protein

Cat.No. : TNFSF15-1071H
Product Overview : Recombinant Human TNFSF15 protein was expressed in Escherichia coli.
Availability July 14, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 72-251 a.a.
Description : The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is abundantly expressed in endothelial cells, but is not expressed in either B or T cells. The expression of this protein is inducible by TNF and IL-1 alpha. This cytokine is a ligand for receptor TNFRSF25 and decoy receptor TNFRSF21/DR6. It can activate NF-kappaB and MAP kinases, and acts as an autocrine factor to induce apoptosis in endothelial cells. This cytokine is also found to inhibit endothelial cell proliferation, and thus may function as an angiogenesis inhibitor. Two transcript variants encoding different isoforms have been found for this gene.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, with 0.02% Tween-20.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by its ability to induce apoptosis using human TF-1 cells is less than 20 ng/ml, corresponding to a specific activity of > 5.0 × 10⁴ IU/mg.
Molecular Mass : Approximately 20.5 kDa, a single non-glycosylated polypeptide chain containing 180 amino acids.
AA Sequence : LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Endotoxin : Less than 0.1 EU/µg of rHuTL-1A/TNFSF15 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name TNFSF15
Official Symbol TNFSF15
Synonyms TNFSF15; tumor necrosis factor (ligand) superfamily, member 15; tumor necrosis factor ligand superfamily member 15; MGC129934; MGC129935; TL1; TL1A; TNF ligand related molecule 1; TNF superfamily ligand TL1A; vascular endothelial cell growth inhibitor; vascular endothelial growth inhibitor 192A; VEGI; VEGI192A; TNF ligand-related molecule 1; vascular endothelial growth inhibitor-192A;
Gene ID 9966
mRNA Refseq NM_001204344
Protein Refseq NP_001191273
MIM 604052
UniProt ID O95150

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFSF15 Products

Required fields are marked with *

My Review for All TNFSF15 Products

Required fields are marked with *

0
cart-icon