Recombinant Human ACVRL1, Fc-tagged, Biotinylated ACVRL1-534H

Recombinant Human ACVRL1, Fc-tagged, Biotinylated

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human ACVRL1, Fc-tagged, Biotinylated

Recombinant Human ACVRL1, Fc-tagged, Biotinylated

ACVRL1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ACVRL1-534H
Product Overview : The recombinant humanACVRL1-Fc fusion protein is expressed as a 325 amino acid protein consisting of Asp22 - Gln118 region of ACVRL1 (UniProt accession #P37023) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source : Human cells
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Immobilized ACVRL1/ALK1 protein binds human BMP9 in a functional ELISA. Inhibits BMP9-induced alkaline phosphatase production by chondrogenic cells.
Molecular Mass : Calculated molecular mass (kDa): 36.3; Estimated by SDS-PAGE under reducing condition (kDa): ~50
AA Sequence : DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLC NHNVSLVLEATQPPSEQPGTDGQSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP REPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : ACVRL1 activin A receptor type II-like 1 [ Homo sapiens ]
Official Symbol : ACVRL1
Synonyms : ACVRL1; activin A receptor type II-like 1; ACVRLK1, ORW2; serine/threonine-protein kinase receptor R3; ALK1; HHT; HHT2; activin receptor-like kinase 1; TGF-B superfamily receptor type I; activin A receptor, type II-like kinase 1; ORW2; SKR3; ALK-1; TSR-I; ACVRLK1;
Gene ID : 94
mRNA Refseq : NM_000020
Protein Refseq : NP_000011
MIM : 601284
UniProt ID : P37023
Chromosome Location : 12q11-q14
Pathway : ALK1 pathway, organism-specific biosystem; ALK1 signaling events, organism-specific biosystem; Id Signaling Pathway, organism-specific biosystem; TGF-beta Receptor Signaling Pathway, organism-specific biosystem;
Function : ATP binding; SMAD binding; activin binding; activin receptor activity, type I; contributes_to activin receptor activity, type I; metal ion binding; nucleotide binding; protein binding; protein serine/threonine kinase activity; receptor activity; receptor signaling protein serine/threonine kinase activity; transforming growth factor beta binding; contributes_to transforming growth factor beta receptor activity, type I; transforming growth factor beta-activated receptor activity; transmembrane receptor protein serine/threonine kinase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy