Recombinant Human C10orf54, Fc-tagged C10orf54-545H

Recombinant Human C10orf54, Fc-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human C10orf54, Fc-tagged

Recombinant Human C10orf54, Fc-tagged

C10orf54 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : C10orf54-545H
Product Overview : The recombinant human B7-H5-Fc fusion protein is expressed as a 390 amino acid protein consisting of Phe33 - Ala194 region of B7-H5 (UniProt accession #Q9H7M9) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source : Human cells
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free).
Bio-activity : Inhibits anti-CD3e antibody induced IL-2 secretion in human T cells.
Molecular Mass : Calculated molecular mass 43.7 kDa; estimated by SDS-PAGE under reducing condition 65-70 kDa probably due to glycosylation
AA Sequence : FKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQA ANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVV YPSSSQDSENITAASTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPP SREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSV MHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : C10orf54 chromosome 10 open reading frame 54 [ Homo sapiens ]
Official Symbol : C10orf54
Synonyms : C10ORF54; chromosome 10 open reading frame 54; platelet receptor Gi24; B7 H5; GI24; SISP1; stress induced secreted protein 1; B7-H5; PP2135;
Gene ID : 64115
mRNA Refseq : NM_022153
Protein Refseq : NP_071436
UniProt ID : Q9H7M9
Chromosome Location : 10q22.1
Function : receptor activity;

Products Types

◆ Recombinant Protein

C10orf54-539HRecombinant Human C10orf54 Protein, Fc-tagged+Inquiry
C10orf54-313HRecombinant Human C10orf54 protein, His-tagged+Inquiry
C10orf54-197HRecombinant Human C10orf54 protein, His-tagged+Inquiry
C10orf54-036HRecombinant Human C10orf54 protein, DDK/HIS-tagged+Inquiry
C10orf54-26MRecombinant Mouse 4632428N05Rik, Fc-tagged+Inquiry

See All C10orf54 Recombinant Protein

◆ Lysates

C10ORF54-1249HCLRecombinant Human C10ORF54 cell lysate+Inquiry
C10orf54-8365HCLRecombinant Human C10orf54 293 Cell Lysate+Inquiry

See All C10orf54 Lysates

Related Gene

C12orf5C19orf10C1QBC1QBPC1QL2C1QTNF1C1QTNF2C1QTNF5C1QTNF6C1QTNF7C1qtnf9C1sC2C4orf7C5C6orf108C11orf30C13orf1C17orf75C1DC1GALT1C1orf38C1QCC20orf30C21orf33C3C4BC5orf32C6orf115C9orf86C9orf96C8BC18orf1C1QAC17orf28C21orf59C20orf43C10orf82C15orf40C16orf72C1orf50C2orf40C9orf41C1QTNF3C1QTNF8C5AR1C10orf2C13orf15C15orf15C15orf29C20orf7C2orf28C3orf10C4AC4BPAC4BPBC4orf6C6C7orf10C7orf16C7orf38C9C9orf95C20orf20C14orf129C16orf53C10orf81C11orf17C12orf24C13orf31C14orf126C16orf35C17orf37C17orf88C18orf23C19orf50C1orf163C1orf57C1orf67C1orf89C21orf2C2orf62C4orf43C6orf199C9orf103C9orf98CC14ORF169C3AR1C14ORF166C19ORF2C19ORF43C1RC20ORF3C7C8AC8GC8orf44-SGK3C14ORF159C10ORF67C16ORF58C21ORF63C10ORF57C10ORF62C11ORF24C11ORF46C3ORF64C10ORF137C13ORF33C10ORF129C11ORF2C8ORF33C7ORF42C6ORF118C7ORF58C14ORF180C14ORF21C14ORF28C14ORF37C1ORF96C12ORF49C12ORF50C12ORF53C9ORF100C9ORF114C13ORF26C13ORF30C11ORF21C9ORF64C9ORF68C10ORF116C21ORF7C14ORF133C14ORF135C17ORF48C17ORF49C17ORF53C11ORF53C11ORF54C5ORF24C5ORF35C5ORF4C5ORF51C17ORF56C17ORF57C1ORF110C1ORF111C1ORF122C1ORF127C1ORF129C7ORF43C7ORF44C7ORF50C16ORF61C16ORF62C16ORF70C16ORF71C16ORF73C16ORF78C16ORF87C17ORF104C17ORF39C17ORF42C14ORF177C14ORF80C15ORF27C15ORF32C15ORF33C15ORF38C15ORF39C15ORF17C15ORF24C15ORF26C15ORF41C15ORF44C15ORF52C15ORF62C16ORF13C16ORF45C16ORF46C16ORF48C16ORF5C16ORF57C1ORF94C1ORF95C21ORF91C22ORF13C22ORF25C22ORF36C2CD2C2CD4CC2ORF18C9ORF89C9ORF153C9ORF156C20ORF72C20ORF79C10ORF93C10ORF95C11ORF16C9ORF78C3ORF62C3ORF67C3ORF70C3ORF75C6ORF201C6ORF223C6ORF25C21ORF56C3ORF15C3ORF17C3ORF18C6ORF1C6ORF10C2ORF89C10ORF88C1ORF87C1ORF93C14ORF105C11ORF73C11ORF74C11ORF85C11ORF87C1ORF84C1QL1C1QL3C20ORF132C20ORF134C20ORF141C20ORF144C5ORF20C20ORF194C20ORF195C20ORF196C20ORF24C20ORF4C21ORF58C21ORF62C2ORF27AC2ORF29C2ORF3C2ORF42C2ORF43C2ORF47C2ORF50C2ORF53C2ORF55C2ORF56C2ORF57C2ORF68C2ORF69C2ORF80C10ORF140C10ORF46C10ORF47C11ORF57C11ORF63C11ORF65C11ORF67C11ORF71C12ORF11C12ORF29C12ORF4C12ORF40C12ORF42C12ORF48C19ORF55C19ORF56C19ORF73C1GALT1C1C12ORF54C12ORF61C12ORF63C12ORF66C12ORF68C14ORF118C18ORF8C19ORF18C19ORF21C19ORF24C19ORF28C19ORF45C19ORF46C19ORF47C19ORF52C19ORF54C17ORF59C17ORF64C17ORF66C17ORF74C17ORF77C17ORF78C17ORF80C17ORF81C20ORF107C20ORF11C20ORF111C20ORF112C1ORF65C6ORF58C6ORF62C7ORF61C7ORF62C7ORF64C9ORF117C9ORF123C17ORF82C17ORF97C18ORF10C18ORF25C18ORF34C18ORF54C18ORF56C1ORF100C1ORF131C1ORF141C1ORF144C1ORF159C1ORF172C1ORF177C1ORF182C1ORF183C1ORF186C1ORF187C1ORF190C7ORF23C1ORF216C1ORF31C1ORF43C1ORF51C1ORF52C1ORF53C1ORF54C1ORF55C1ORF56C1ORF74C1RLC20ORF160C20ORF165C20ORF173C20ORF177C3ORF23C3ORF24C3ORF33C3ORF37C3ORF38C3ORF39C3ORF58C4ORF19C4ORF22C4ORF27C4ORF32C4ORF33C4ORF36C4ORF44C4ORF45C4ORF46C4ORF47C6ORF64C6ORF70C6ORF81C6ORF97C7ORF29C8ORF34C8ORF45C8ORF48C8ORF59C5ORF54C5ORF55C5ORF60C6ORF120C6ORF127C6ORF146C6ORF174C6ORF192C8ORF76C8ORF84C9ORF174C9ORF25C9ORF3C9ORF30C9ORF4C9ORF40C9ORF43C9ORF46C7ORF31C9ORF128C9ORF150C9ORF152C9ORF167C9ORF170C19ORF29C11ORF68C9ORF9C9ORF82C20ORF54C1QTNF4C6ORF94C10ORF28C14ORF1C19ORF40C5ORF64C2CD4BC2ORF63C17ORF70C10ORF54C19ORF38C22ORF31C19ORF33C19ORF6C5ORF41C20ORF201C20ORF203C5ORF39C10ORF96C7ORF49C1ORF35C4ORF49C14ORF49C1ORF63C12ORF75C5ORF13C9ORF102C10ORF27C22ORF42C13ORF27C11ORF58C1ORF116C2ORF51C2CD2LC7ORF11C3ORF52C11H16ORF80C1rbC. albicansC15orf55C8orf86C1orf229C20orf78C17orf105C17orf108C9orf172C1orf228C10orf107C14orf2C14orf166BC19orf44C19orf57C19orf59C19orf60C19orf66C19orf70C20orf26C10orf111C10orf113C10orf118C10orf12C10orf120C10orf128C10orf32C10orf35C10orf53C10orf55C10orf68C10orf71C10orf90C10orf91C11orf1C11orf10C11orf34C11orf45C11orf48C11orf49C11orf52C11orf70C11orf80C11orf84C11orf86C11orf9C12orf23C12orf39C12orf43C12orf45C12orf52C12orf60C12orf70C12orf71C12orf73C14orf101C14orf43C14orf45C14orf93C15orf23C15orf43C15orf53C15orf57C15orf59C16orf79C16orf80C16orf88C17orf47C17orf58C17orf67C17orf99C18orf26C18orf32C18orf62C19orf26C19orf42C1orf105C1orf106C1orf109C1orf112C1orf114C1orf123C1orf158C1orf162C1orf168C1orf173C1orf174C1orf192C1orf194C1orf198C1orf21C1orf27C1orf61C1orf64C1orf68C1orf85C1orf86C20orf151C20orf152C20orf166C22orf15C22orf23C22orf28C22orf29C22orf32C2CD3C2orf44C2orf65C2orf66C2orf72C2orf76C2orf83C3orf20C3orf26C4orf21C4orf3C4orf40C5orf15C5orf22C5orf34C5orf44C5orf48C6orf106C6orf130C6orf132C6orf15C6orf162C6orf163C6orf165C6orf195C6orf222C6orf225C6orf57C6orf89C8orf58C8orf74C9orf11C9orf116C9orf131C9orf135C9orf139C7orf25C7orf34C7orf41C7orf45C7orf53C7orf57C7orf59C7orf60C8orf40C8orf4C8orf42C8orf44C8orf47C9orf16C9orf163C9orf169C9orf37C9orf57C9orf50C9orf66C9orf84C9orf91C19ORF76C8orf85C15ORF38-AP3S2C1orf115C1ORF233C10orf11C11orf20C11orf35C11orf40C11orf83C11orf88C11ORF93C11ORF94C11ORF95C13orf35C14orf178C16orf55C17orf100C17orf102C17ORF107C17orf79C17orf96C19orf69C2orf27BC2orf48C2orf88C2ORF91C22orf24C22orf26C4orf17C5ORF63C6ORF228C6orf47C6orf52C7orf26C8orf37C8orf82C8ORF87C1QL4C19orf63C87977C030019I05RikC530028O21RikC330019G07RikC5ORF65C030006K11RikC030030A07RikC030039L03RikC030046E11RikC030046I01RikC030048B08RikC330005M16RikC330006K01RikC330007P06RikC330018D20RikC330021F23RikC330027C09RikC530008M17RikC630004H02RikC5ORF62C17ORF109C17ORF110C15orf42C3orf71C1QTNF9BC2cd4aC2cd4dC1orf101C1orf146C1orf185C1orf189C1orf204C1orf210C1orf212C1orf226C1orf227C1H6orf35C10orf105C10orf131C10orf76C11orf31C11orf91C11orf96C12orf44C12orf56C12orf57C12orf76C14orf142C14orf182C14orf79C15orf56C15orf60C15orf61C16orf3C16orf52C16orf59C16orf82C16orf86C16orf89C16orf90C16orf91C16orf92C16orf93C16orf95C17orf72C17orf89C18orf42C18orf63C19orf48C19orf71C19orf77C2orf15C2orf49C2orf54C2orf61C2orf70C2orf73C2orf74C2orf78C2orf81C2orf82C20orf118C20orf85C22orf46C3orf14C3orf22C3orf35C3orf43C3orf45C3orf79C3orf80C4orf29C4orf34C4orf48C4orf51C4orf52C5orf30C5orf38C5orf42C5orf45C5orf47C5orf52C5orf58C6orf136C6orf141C6orf170C6orf203C6orf211C6orf226C6orf48C6orf99C7orf33C7orf63C7orf65C7orf66C7orf71C7orf73C8orf46C8orf73C9orf129C9orf142C9orf171C9orf24C9orf47C9orf85C130022K22RikC3orf19C14orf38C1raC4bpC77080C77370C78339C80913C86695C87414C87436C130026I21RikC130039O16RikC130050O18RikC130060K24RikC130074G19RikC130079G13RikC230052I12RikC230081A13RikC20orf94C3orf78C3orf77C14orf176C16orf7C2orf39C11orf42C12orf65C15orf48C19orf80C11H2orf49

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy