"CD19" Related Products

Expand
Expand
Expand

Recombinant Human CD19, His-tagged, Biotinylated

Cat.No.: CD19-558H
Product Overview: The recombinant human CD19 ECD is expressed as a 271 amino acid protein consisting of Pro20 - Val279 region of CD19 (UniProt accession #P15391) and a C-terminal His-tag. It contains 5 potential sites for N-linked glycosylation.
Source: Human cells
Species: Human
Tag: His
Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity: Binds anti-CD19 monoclonal antibody human IgG1 with high affinity (KD< 1 nm) measured by elisa with immobilized cd19 ecd protein (100>
Molecular Mass: Calculated molecular mass (kDa): 29.9; Estimated by SDS-PAGE under reducing condition (kDa): ~45 probably due to glycosylation
AA Sequence: PEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKPFLKLSLGLPGLGIHMRPLAIWLFIFNVSQQMGGF YLCQPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWE GEPPCLPPRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDRPARDMWVM ETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVSTGHHHHHHHH
Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity: >95% judged by SDS-PAGE under reducing condition
Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name: CD19 CD19 molecule [ Homo sapiens ]
Official Symbol: CD19
Synonyms: CD19; CD19 molecule; CD19 antigen; B-lymphocyte antigen CD19; differentiation antigen CD19; T-cell surface antigen Leu-12; B-lymphocyte surface antigen B4; B4; CVID3; MGC12802;
Gene ID: 930
mRNA Refseq: NM_001178098
Protein Refseq: NP_001171569
MIM: 107265
UniProt ID: P15391
Chromosome Location: 16p11.2
Pathway: Adaptive Immune System, organism-specific biosystem; Antigen Activates B Cell Receptor Leading to Generation of Second Messengers, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem; BCR signaling pathway, organism-specific biosystem; Hematopoietic cell lineage, organism-specific biosystem;
Function: receptor signaling protein activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.