Recombinant Human CD19, His-tagged, Biotinylated CD19-558H

Recombinant Human CD19, His-tagged, Biotinylated

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CD19, His-tagged, Biotinylated

Recombinant Human CD19, His-tagged, Biotinylated

CD19 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CD19-558H
Product Overview : The recombinant human CD19 ECD is expressed as a 271 amino acid protein consisting of Pro20 - Val279 region of CD19 (UniProt accession #P15391) and a C-terminal His-tag. It contains 5 potential sites for N-linked glycosylation.
Source : Human cells
Species : Human
Tag : His
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Binds anti-CD19 monoclonal antibody human IgG1 with high affinity (KD< 1 nm) measured by elisa with immobilized cd19 ecd protein (100>
Molecular Mass : Calculated molecular mass (kDa): 29.9; Estimated by SDS-PAGE under reducing condition (kDa): ~45 probably due to glycosylation
AA Sequence : PEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKPFLKLSLGLPGLGIHMRPLAIWLFIFNVSQQMGGF YLCQPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWE GEPPCLPPRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDRPARDMWVM ETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVSTGHHHHHHHH
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : CD19 CD19 molecule [ Homo sapiens ]
Official Symbol : CD19
Synonyms : CD19; CD19 molecule; CD19 antigen; B-lymphocyte antigen CD19; differentiation antigen CD19; T-cell surface antigen Leu-12; B-lymphocyte surface antigen B4; B4; CVID3; MGC12802;
Gene ID : 930
mRNA Refseq : NM_001178098
Protein Refseq : NP_001171569
MIM : 107265
UniProt ID : P15391
Chromosome Location : 16p11.2
Pathway : Adaptive Immune System, organism-specific biosystem; Antigen Activates B Cell Receptor Leading to Generation of Second Messengers, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem; BCR signaling pathway, organism-specific biosystem; Hematopoietic cell lineage, organism-specific biosystem;
Function : receptor signaling protein activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy