Recombinant Human CD34, His-tagged, Biotinylated CD34-572H

Recombinant Human CD34, His-tagged, Biotinylated

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CD34, His-tagged, Biotinylated

Recombinant Human CD34, His-tagged, Biotinylated

CD34 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CD34-572H
Product Overview : The recombinant human CD34 ECD protein is expressed as a 280-amino acid protein consisting of Ser32 - Thr290 region of (UniProt accession #P28906) and a C-terminal His-tag. It contains 9 potential N-linked glycosylation sites.
Source : Human cells
Species : Human
Tag : His
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Interacts with L-selectin and supports the adhesion of the human umbilical vein endothelial cell line (HUVEC). Binds anti-CD34 monoclonal antibodies, human IgG1 and rabbit IgG by ELISA with this immobilized protein.
Molecular Mass : Calculated molecular mass (kDa): 30; Estimated by SDS-PAGE under reducing condition (kDa): 75-90 suggesting that the protein may be heavily glycosylated.
AA Sequence : SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNT NSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGI REVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEIS SKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTSTTENLYFQGSTGHHHHHHHH
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >92% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : CD34 CD34 molecule [ Homo sapiens ]
Official Symbol : CD34
Synonyms : CD34; CD34 molecule; CD34 antigen; hematopoietic progenitor cell antigen CD34;
Gene ID : 947
mRNA Refseq : NM_001025109
Protein Refseq : NP_001020280
MIM : 142230
UniProt ID : P28906
Chromosome Location : 1q32
Pathway : Adaptive Immune System, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Immune System, organism-specific biosystem;
Function : carbohydrate binding; sulfate binding; transcription factor binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy