"CDNF" Related Products

Expand
Expand
Expand

Recombinant Human CDNF, His-tagged, Biotinylated

Cat.No.: CDNF-591H
Product Overview: The recombinant human CDNF is expressed as a 174 amino acid protein consisting of Gln25 - Leu187 region of CDNF (UniProt entry Q49AH0) and a C-terminal poly-Histidine tag.
Source: Human cells
Species: Human
Tag: His
Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity: CDNF is reported to enhance neurite outgrowth of E18 rat embryonic cortical neurons and increases neurite outgrowth when immobilized at 6 - 24 μg/mL on a nitrocellulose- coated microplate.
Molecular Mass: Calculated molecular mass 19.9 kDa; estimated by SDS-PAGE under reducing condition ~22 kDa with a higher molecular mass band (~25 kDa) resembling a glycosylated state.
AA Sequence: QGQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEV TRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQE LAPKYAATHPKTELSTGHHHHHHHH
Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity: >95% judged by SDS-PAGE under reducing condition
Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name: CDNF cerebral dopamine neurotrophic factor [ Homo sapiens ]
Official Symbol: CDNF
Synonyms: CDNF; cerebral dopamine neurotrophic factor; arginine rich, mutated in early stage tumors like 1 , ARMETL1; conserved dopamine neurotrophic factor; ARMET-like protein 1; arginine-rich, mutated in early stage tumors-like 1; ARMETL1;
Gene ID: 441549
mRNA Refseq: NM_001029954
Protein Refseq: NP_001025125
MIM: 611233
UniProt ID: Q49AH0
Chromosome Location: 10p13
Function: growth factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.