"TEP1" Related Products

Recombinant Human TEP1 protein, GST-tagged

Cat.No.: TEP1-592H
Product Overview: Recombinant Human TEP1(2529 a.a. - 2627 a.a.), fussed with GST at N-terminal, was expressed in Wheat Germ.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 36.63 kDa
Protein length: 2529 a.a. - 2627 a.a.
AA Sequence: ASMDSDASMDSEPTPHLKTRQRRKIHSGSVTALHVLPELLVTASKDRDVKLWERPSMQLLGLFRCEGSVSCLEPW LGANSTLQLAVGDVQGNVYFLNWE
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: TEP1 telomerase-associated protein 1 [ Homo sapiens ]
Official Symbol: TEP1
Synonyms: TEP1; telomerase-associated protein 1; telomerase protein component 1; p240; TLP1; TP1; TROVE domain family; member 1; TROVE1; VAULT2; telomerase protein 1; p80 telomerase homolog; TROVE domain family, member 1;
Gene ID: 7011
mRNA Refseq: NM_007110
Protein Refseq: NP_009041
MIM: 601686
UniProt ID: Q99973
Chromosome Location: 14q11.2
Function: ATP binding; RNA binding; nucleotide binding; contributes_to telomerase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.