Recombinant Human TEP1 protein, GST-tagged

Cat.No. : TEP1-592H
Product Overview : Recombinant Human TEP1(2529 a.a. - 2627 a.a.), fussed with GST at N-terminal, was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 2529 a.a. - 2627 a.a.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.63 kDa
AA Sequence : ASMDSDASMDSEPTPHLKTRQRRKIHSGSVTALHVLPELLVTASKDRDVKLWERPSMQLLGLFRCEGSVSCLEPW LGANSTLQLAVGDVQGNVYFLNWE
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name TEP1 telomerase-associated protein 1 [ Homo sapiens ]
Official Symbol TEP1
Synonyms TEP1; telomerase-associated protein 1; telomerase protein component 1; p240; TLP1; TP1; TROVE domain family; member 1; TROVE1; VAULT2; telomerase protein 1; p80 telomerase homolog; TROVE domain family, member 1;
Gene ID 7011
mRNA Refseq NM_007110
Protein Refseq NP_009041
MIM 601686
UniProt ID Q99973
Chromosome Location 14q11.2
Function ATP binding; RNA binding; nucleotide binding; contributes_to telomerase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TEP1 Products

Required fields are marked with *

My Review for All TEP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon