Recombinant Human TEP1 protein, GST-tagged TEP1-592H

Recombinant Human TEP1 protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human TEP1 protein, GST-tagged

Recombinant Human TEP1 protein, GST-tagged

TEP1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : TEP1-592H
Product Overview : Recombinant Human TEP1(2529 a.a. - 2627 a.a.), fussed with GST at N-terminal, was expressed in Wheat Germ.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.63 kDa
Protein length : 2529 a.a. - 2627 a.a.
AA Sequence : ASMDSDASMDSEPTPHLKTRQRRKIHSGSVTALHVLPELLVTASKDRDVKLWERPSMQLLGLFRCEGSVSCLEPW LGANSTLQLAVGDVQGNVYFLNWE
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : TEP1 telomerase-associated protein 1 [ Homo sapiens ]
Official Symbol : TEP1
Synonyms : TEP1; telomerase-associated protein 1; telomerase protein component 1; p240; TLP1; TP1; TROVE domain family; member 1; TROVE1; VAULT2; telomerase protein 1; p80 telomerase homolog; TROVE domain family, member 1;
Gene ID : 7011
mRNA Refseq : NM_007110
Protein Refseq : NP_009041
MIM : 601686
UniProt ID : Q99973
Chromosome Location : 14q11.2
Function : ATP binding; RNA binding; nucleotide binding; contributes_to telomerase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy