Recombinant Human TEP1 protein, GST-tagged
Cat.No. : | TEP1-592H |
Product Overview : | Recombinant Human TEP1(2529 a.a. - 2627 a.a.), fussed with GST at N-terminal, was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 2529 a.a. - 2627 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | ASMDSDASMDSEPTPHLKTRQRRKIHSGSVTALHVLPELLVTASKDRDVKLWERPSMQLLGLFRCEGSVSCLEPW LGANSTLQLAVGDVQGNVYFLNWE |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | TEP1 telomerase-associated protein 1 [ Homo sapiens ] |
Official Symbol | TEP1 |
Synonyms | TEP1; telomerase-associated protein 1; telomerase protein component 1; p240; TLP1; TP1; TROVE domain family; member 1; TROVE1; VAULT2; telomerase protein 1; p80 telomerase homolog; TROVE domain family, member 1; |
Gene ID | 7011 |
mRNA Refseq | NM_007110 |
Protein Refseq | NP_009041 |
MIM | 601686 |
UniProt ID | Q99973 |
Chromosome Location | 14q11.2 |
Function | ATP binding; RNA binding; nucleotide binding; contributes_to telomerase activity; |
◆ Recombinant Proteins | ||
TEP1-6409H | Recombinant Human TEP1 Protein (Glu2368-Glu2627), N-His tagged | +Inquiry |
TEP1-551H | Recombinant Human TEP1 | +Inquiry |
TEP1-9127M | Recombinant Mouse TEP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TEP1-2804H | Recombinant Human TEP1 protein, His & T7-tagged | +Inquiry |
TEP1-5325H | Recombinant Human TEP1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TEP1 Products
Required fields are marked with *
My Review for All TEP1 Products
Required fields are marked with *
0
Inquiry Basket