Recombinant Human TEP1 protein, GST-tagged
| Cat.No. : | TEP1-592H |
| Product Overview : | Recombinant Human TEP1(2529 a.a. - 2627 a.a.), fussed with GST at N-terminal, was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 2529 a.a. - 2627 a.a. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | ASMDSDASMDSEPTPHLKTRQRRKIHSGSVTALHVLPELLVTASKDRDVKLWERPSMQLLGLFRCEGSVSCLEPW LGANSTLQLAVGDVQGNVYFLNWE |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | TEP1 telomerase-associated protein 1 [ Homo sapiens ] |
| Official Symbol | TEP1 |
| Synonyms | TEP1; telomerase-associated protein 1; telomerase protein component 1; p240; TLP1; TP1; TROVE domain family; member 1; TROVE1; VAULT2; telomerase protein 1; p80 telomerase homolog; TROVE domain family, member 1; |
| Gene ID | 7011 |
| mRNA Refseq | NM_007110 |
| Protein Refseq | NP_009041 |
| MIM | 601686 |
| UniProt ID | Q99973 |
| Chromosome Location | 14q11.2 |
| Function | ATP binding; RNA binding; nucleotide binding; contributes_to telomerase activity; |
| ◆ Recombinant Proteins | ||
| TEP1-6011R | Recombinant Rat TEP1 Protein | +Inquiry |
| TEP1-4174H | Recombinant Human TEP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TEP1-6409H | Recombinant Human TEP1 Protein (Glu2368-Glu2627), N-His tagged | +Inquiry |
| TEP1-5670R | Recombinant Rat TEP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TEP1-592H | Recombinant Human TEP1 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TEP1 Products
Required fields are marked with *
My Review for All TEP1 Products
Required fields are marked with *
