Recombinant Human KDR, His-tagged, Biotinylated KDR-630H

Recombinant Human KDR, His-tagged, Biotinylated

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human KDR, His-tagged, Biotinylated

Recombinant Human KDR, His-tagged, Biotinylated

KDR Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : KDR-630H
Product Overview : The recombinant human KDR/VEGFR2/CD309 extracellular or ecto-domain (ECD) is expressed as a 756 amino acid protein consisting of Ala20 - Glu764 region of KDR and a C-terminal His-tag. It contains 18 potential N-linked glycosylation sites.
Source : Human cells
Species : Human
Tag : His
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Binds VEGF and inhibits VEGF-dependent proliferation of human umbilical vein endothelial cells (HUVEC).
Molecular Mass : Calculated molecular mass (kDa): 84.6; Estimated by SDS-PAGE under reducing condition (kDa): 110-120 suggesting that the protein is glycosylated.
AA Sequence : ASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVI GNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEK RFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKL VLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGITRSDQGLYTCAASSGLMTK KNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPAKYLGYPPPEIKWYKNGIPLESNHTIKAGHVLTIMEVSE RDTGNYTVILTNPISKEKQSHVVSLVVYVPPQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEE CANEPSHAVSVTNPYPCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKVGRG ERVISFHVTRGPEITLQPDMQPTEQESVSLWCTADRSTFENLTWYKLGPQPLPIHVGELPTPVCKNLDTLWKLN ATMFSNSTNDILIMELKNASLQDQGDYVCLAQDRKTKKRHCVVRQLTVLERVAPTITGNLENQTTSIGESIEVS CTASGNPPPQIMWFKDNETLVEDSGIVLKDGNRNLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEKT NLESTGHHHHHHHH
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity : >90% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : KDR kinase insert domain receptor (a type III receptor tyrosine kinase) [ Homo sapiens ]
Official Symbol : KDR
Synonyms : KDR; kinase insert domain receptor (a type III receptor tyrosine kinase); vascular endothelial growth factor receptor 2; CD309; FLK1; VEGFR; VEGFR2; soluble VEGFR2; fetal liver kinase 1; fetal liver kinase-1; protein-tyrosine kinase receptor Flk-1; tyrosine kinase growth factor receptor;
Gene ID : 3791
mRNA Refseq : NM_002253
Protein Refseq : NP_002244
MIM : 191306
UniProt ID : P35968
Chromosome Location : 4q11-q12
Pathway : Angiogenesis, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem;
Function : ATP binding; Hsp90 protein binding; growth factor binding; integrin binding; nucleotide binding; protein binding; protein tyrosine kinase activity; receptor activity; receptor signaling protein tyrosine kinase activity; transmembrane receptor protein tyrosine kinase activity; vascular endothelial growth factor-activated receptor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy