"SIGLEC9" Related Products

Expand

Recombinant Human SIGLEC9, Fc-tagged

Cat.No.: SIGLEC9-677H
Product Overview: The recombinant human CD329-Fc is expressed as a 556 amino acid protein consisting of Gln18 - Gly348 region of CD329 and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source: Human cells
Species: Human
Tag: Fc
Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Bio-activity: Immobilized protein supports the adhesion of human red blood cells. Blocks CD329-binding to its ligand and signaling activity.
Molecular Mass: Calculated molecular mass (kDa): 61.4; Estimated by SDS-PAGE under reducing condition (kDa): 80-90 (probably due to glycosylation)
AA Sequence: QTSKLLTMQSSVTVQEGLCVHVPCSFSYPSHGWIYPGPVVHGYWFREGANTDQDAPVATNNPARAVWEETRDRF HLLGDPHTKNCTLSIRDARRSDAGRYFFRMEKGSIKWNYKHHRLSVNVTALTHRPNILIPGTLESGCPQNLTCS VPWACEQGTPPMISWIGTSVSPLDPSTTRSSVLTLIPQPQDHGTSLTCQVTFPGASVTTNKTVHLNVSYPPQN LTMTVFQGDGTVSTVLGNGSSLSLPEGQSLRLVCAVDAVDSNPPARLSLSWRGLTLCPSQPSNPGVLELPWVHL RDAAEFTCRAQNPLGSQQVYLNVSLQSKATSGVTQGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE KTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity: >95% judged by SDS-PAGE under reducing condition
Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name: SIGLEC9 sialic acid binding Ig-like lectin 9 [ Homo sapiens ]
Official Symbol: SIGLEC9
Synonyms: SIGLEC9; sialic acid binding Ig-like lectin 9; sialic acid-binding Ig-like lectin 9; CD329; protein FOAP-9; CDw329; FOAP-9; siglec-9; OBBP-LIKE;
Gene ID: 27180
mRNA Refseq: NM_001198558
Protein Refseq: NP_001185487
MIM: 605640
UniProt ID: Q9Y336
Chromosome Location: 19q13.3-q13.4
Function: sugar binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.