Recombinant CPIm protein, His-tagged CPIm-01L

Recombinant CPIm protein, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant CPIm protein, His-tagged

Recombinant CPIm protein, His-tagged

CPIm Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CPIm-01L
Product Overview : Recombinant CPIm was expressed in E. coli.
Description : CPIm is a mutant by site-directed mutagenesis of optimized CPI gene (Asn66-Lsy66).
Source : E. coli
Tag : His
AA Sequence : MMSVKGVLLVPFLSLFGVVVLVNCLGHGNMESEARVVGGWQERSPDDNEIQEMLPSILTKVNQQSKDAYHLMPIK VLKVSSQVVAGMKYKMEIQAARSDCKKSSNEKIDLKTCKKLEGHPDQZ

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy