"CPIm" Related Products

Recombinant CPIm protein, His-tagged

Cat.No.: CPIm-01L
Product Overview: Recombinant CPIm was expressed in E. coli.
Description: CPIm is a mutant by site-directed mutagenesis of optimized CPI gene (Asn66-Lsy66).
Source: E. coli
Tag: His
AA Sequence: MMSVKGVLLVPFLSLFGVVVLVNCLGHGNMESEARVVGGWQERSPDDNEIQEMLPSILTKVNQQSKDAYHLMPIK VLKVSSQVVAGMKYKMEIQAARSDCKKSSNEKIDLKTCKKLEGHPDQZ

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.