Recombinant Human TMPRSS6 protein, GST-tagged TMPRSS6-126H

Recombinant Human TMPRSS6 protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human TMPRSS6 protein, GST-tagged

Recombinant Human TMPRSS6 protein, GST-tagged

TMPRSS6 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : TMPRSS6-126H
Product Overview : Recombinant Human TMPRSS6(1 a.a. - 461 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 78 kDa
Protein length : 1 a.a. - 461 a.a.
AA Sequence : MLLLFHSKRMPVAEAPQVAGGQGDGGDGEEAEPEGMFKACEDSKRKARGYLRLVPLFVLLALLVLASAGVLLWYF LGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQKMLKELITSTRLGTYYNSSSVYSFGEGPLTC FFWFILQIPEHRRLMLSPEVVQALLVEELLSTVNSSAAVPYRAEYEVDPEGLVILEASVKDIAALNSTLGCYRYS YVGQGQVLRLKGPDHLASSCLWHLQGPKDLMLKLRLEWTLAECRDRLAMYDVAGPLEKRLITSVYGCSRQEPVVE VLASGAIMAVVWKKGLHSYYDPFVLSVQPVVFQACEVNLTLDNRLDSQGVLSTPYFPSYYSPQTHCSWHLTVPSL DYGLALWFDAYALRRQKYDLPCTQGQWTIQNRRYHFLSSLWLPFLPPPPSLPSSTVTPSLEAQVPNLRGAARGAS RGWGWCQACCP
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : TMPRSS6 transmembrane protease, serine 6 [ Homo sapiens ]
Official Symbol : TMPRSS6
Synonyms : TMPRSS6; transmembrane protease, serine 6; transmembrane protease serine 6; FLJ30744; matriptase-2; type II transmembrane serine protease 6; membrane-bound mosaic serine proteinase matriptase-2; IRIDA;
Gene ID : 164656
mRNA Refseq : NM_153609
Protein Refseq : NP_705837
MIM : 609862
UniProt ID : Q8IU80
Chromosome Location : 22q13.1
Function : peptidase activity; serine-type endopeptidase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy