"TMPRSS6" Related Products

Expand
Expand

Recombinant Human TMPRSS6 protein, GST-tagged

Cat.No.: TMPRSS6-126H
Product Overview: Recombinant Human TMPRSS6(1 a.a. - 461 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 78 kDa
Protein length: 1 a.a. - 461 a.a.
AA Sequence: MLLLFHSKRMPVAEAPQVAGGQGDGGDGEEAEPEGMFKACEDSKRKARGYLRLVPLFVLLALLVLASAGVLLWYF LGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQKMLKELITSTRLGTYYNSSSVYSFGEGPLTC FFWFILQIPEHRRLMLSPEVVQALLVEELLSTVNSSAAVPYRAEYEVDPEGLVILEASVKDIAALNSTLGCYRYS YVGQGQVLRLKGPDHLASSCLWHLQGPKDLMLKLRLEWTLAECRDRLAMYDVAGPLEKRLITSVYGCSRQEPVVE VLASGAIMAVVWKKGLHSYYDPFVLSVQPVVFQACEVNLTLDNRLDSQGVLSTPYFPSYYSPQTHCSWHLTVPSL DYGLALWFDAYALRRQKYDLPCTQGQWTIQNRRYHFLSSLWLPFLPPPPSLPSSTVTPSLEAQVPNLRGAARGAS RGWGWCQACCP
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: TMPRSS6 transmembrane protease, serine 6 [ Homo sapiens ]
Official Symbol: TMPRSS6
Synonyms: TMPRSS6; transmembrane protease, serine 6; transmembrane protease serine 6; FLJ30744; matriptase-2; type II transmembrane serine protease 6; membrane-bound mosaic serine proteinase matriptase-2; IRIDA;
Gene ID: 164656
mRNA Refseq: NM_153609
Protein Refseq: NP_705837
MIM: 609862
UniProt ID: Q8IU80
Chromosome Location: 22q13.1
Function: peptidase activity; serine-type endopeptidase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.