Recombinant Human TLR9 protein

Cat.No. : TLR9-452H
Product Overview : Recombinant Human TLR9 was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Citation
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural andfunctional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is preferentially expressed in immune cell rich tissues, such as spleen, lymph node, bone marrow and peripheral blood leukocytes. Studies in mice and human indicate that this receptor mediates cellular response to unmethylatedCpG dinucleotides in bacterial DNA to mount an innate immune response.
Form : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Molecular Mass : 113.52 kDa
AA Sequence : MGFCRSALHPLSLLVQAIMLAMTLALGTLPAFLPCELQPHGLVNCNWLFLKSVPHFSMAAPRGNVTSLSLSSNRI HHLHDSDFAHLPSLRHLNLKWNCPPVGLSPMHFPCHMTIEPSTFLAVPTLEELNLSYNNIMTVPALPKSLISLSL SHTNILMLDSASLAGLHALRFLFMDGNCYYKNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVPRNLPSSLEYL LLSYNRIVKLAPEDLANLTALRVLDVGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN ASWFRGLGNLRVLDLSENFLYKCITKTKAFQGLTQLRKLNLSFNYQKRVSFAHLSLAPSFGSLVALKELDMHGIF FRSLDETTLRPLARLPMLQTLRLQMNFINQAQLGIFRAFPGLRYVDLSDNRISGASELTATMGEADGGEKVWLQP GDLAPAPVDTPSSEDFRPNCSTLNFTLDLSRNNLVTVQPEMFAQLSHLQCLRLSHNCISQAVNGSQFLPLTGLQV LDLSHNKLDLYHEHSFTELPRLEALDLSYNSQPFGMQGVGHNFSFVAHLRTLRHLSLAHNNIHSQVSQQLCSTSL RALDFSGNALGHMWAEGDLYLHFFQGLSGLIWLDLSQNRLHTLLPQTLRNLPKSLQVLRLRDNYLAFFKWWSLHF LPKLEVLDLAGNQLKALTNGSLPAGTRLRRLDVSCNSISFVAPGFFSKAKELRELNLSANALKTVDHSWFGPLAS ALQILDVSANPLHCACGAAFMDFLLEVQAAVPGLPSRVKCGSPGQLQGLSIFAQDLRLCLDEALSWDCFALSLLA VALGLGVPMLHHLCGWDLWYCFHLCLAWLPWRGRQSGRDEDALPYDAFVVFDKTQSAVADWVYNELRGQLEECRG RWALRLCLEERDWLPGKTLFENLWASVYGSRKTLFVLAHTDRVSGLLRASFLLAQQRLLEDRKDVVVLVILSPDG RRSRYVRLRQRLCRQSVLLWPHQPSGQRSFWAQLGMALTRDNHHFYNRNFCQGPTAE
Applications : Antibody Production;Functional Study: Recommended usage only, not validated yet;Compound Screening: Recommended usage only, not validated yet.
Notes : Heating may cause protein aggregation. Please do not heat this product before electrophoresis. Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name TLR9 toll-like receptor 9 [ Homo sapiens ]
Official Symbol TLR9
Synonyms TLR9; toll-like receptor 9; CD289;
Gene ID 54106
mRNA Refseq NM_017442
Protein Refseq NP_059138
MIM 605474
UniProt ID Q9NR96
Chromosome Location 3p21.3
Pathway African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; IRS-mediated signalling, organism-specific biosystem;
Function interleukin-1 receptor binding; receptor activity; siRNA binding;

Toll-Like Receptor 9-Mediated Neuronal Innate Immune Reaction Is Associated with Initiating a Pro-Regenerative State in Neurons of the Dorsal Root Ganglia Non-Associated with Sciatic Nerve Lesion

Journal: International Journal of Molecular Sciences    PubMed ID: 34299065    Data: 2021/7/12

Authors: Petr Dubovy, Ivana Hradilová-Sví?enská, Ilaria Tonazzini

Article Snippet:Another portion was incubated with mouse monoclonal anti-TLR9 (1:100; sc-52966, Santa Cruz Biotechnology, Heidelberg, Germany) and one of either rabbit monoclonal anti–Rab7 (1:100; #9367, Cell Signaling Technology, The Netherlands) or rabbit polyclonal anti-GRP78 (1:500; ab53068, Abcam, Cambridge, UK) antibodies.one of either rabbit monoclonal anti–Rab7 (1:100; #9367, Cell Signaling Technology, The Netherlands) or rabbit polyclonal anti-GRP78 (1:500; ab53068, Abcam, Cambridge, UK) antibodies. ... A mixture (1:1) of affinity purified TRITC-conjugated donkey anti-rabbit and FITC-conjugated donkey anti-mouse secondary antibodies (1:100; AP182R and AP192F, EMD Millipore, Tamecula, CA, USA) was applied at room temperature for 90 min. Control sections were incubated without the primary antibodies, with preabsorbed polyclonal TLR9 antibody (20 μg/mL, TLR9 blocking peptide, MBS-152758, MyBioSource, San Diego, CA, USA), preabsorbed monoclonal antibody using recombinant human TLR9 protein (10 μg/mL, TLR9-48H, Creative-Biomart, Shirley, NY, USA) or with a reverse combination of primary and secondary antibodies.. The control sections displayed no immunostaining.The control sections displayed no immunostaining.

Representative sections of DRG from naive rat ( a ) and rats with sterile sham- ( b ), SNC- ( c – f ) or CSNT- ( g – j ) interventions for 7 days. The DRG sections of lumbar (DRG-L4) and cervical (DRG-C7) segments of both ipsilateral ( i ) and contralateral ( c ) sides were immunostained for TLR9 using a rabbit polyclonal antibody and donkey TRITC-conjugated anti-rabbit secondary antibody under the same conditions. Besides neuronal bodies, increased TLR9 immunofluorescence was found in satellite glial cells enveloping the neuronal bodies of ipsilateral DRG-L4 after SNC (arrow in c) and bilaterally in DRG-L4 after CSNT (arrows in g,h). Scale bars = 40 μm.

Representative sections of DRG from naive rat ( a ) and rats with sterile sham- ( b ), SNC- ( c – f ) or CSNT- ( g – j ) interventions for 7 days. The DRG sections of lumbar (DRG-L4) and cervical (DRG-C7) segments of both ipsilateral ( i ) and contralateral ( c ) sides were immunostained for TLR9 using a rabbit polyclonal antibody and donkey TRITC-conjugated anti-rabbit secondary antibody under the same conditions. Besides neuronal bodies, increased TLR9 immunofluorescence was found in satellite glial cells enveloping the neuronal bodies of ipsilateral DRG-L4 after SNC (arrow in c) and bilaterally in DRG-L4 after CSNT (arrows in g,h). Scale bars = 40 μm.

Results from image analysis of  TLR9  immunofluorescence intensity in the dorsal root ganglia (DRG) of cervical (C6-C8) and lumbar (L4-L5) spinal segments. The DRG were removed from naive rats (Naive) as well as those subjected to Sham, SNC and CSNT operation ( n = 6 for each group). The DRG of operated rats were removed from both ipsilateral (Ipsi) and contralateral (Contra) side to unilateral sciatic nerve lesions. The immunofluorescence intensity of  TLR9  is expressed as mean ± SD.

Results from image analysis of TLR9 immunofluorescence intensity in the dorsal root ganglia (DRG) of cervical (C6-C8) and lumbar (L4-L5) spinal segments. The DRG were removed from naive rats (Naive) as well as those subjected to Sham, SNC and CSNT operation ( n = 6 for each group). The DRG of operated rats were removed from both ipsilateral (Ipsi) and contralateral (Contra) side to unilateral sciatic nerve lesions. The immunofluorescence intensity of TLR9 is expressed as mean ± SD.

Double immunofluorescence staining for TLR9 and GS as a marker of satellite glial cells (SGCs). Sections of lumbar DRG ipsilateral (DRGL4i) to sham operation (Sham) and CSNT were immunostained with a mixture of rabbit polyclonal anti-TLR9 ( a , d ) and mouse monoclonal anti-GS ( b , e ) antibodies. Immunostaining was visualized with TRITC-conjugated donkey anti-rabbit and FITC-conjugated donkey anti-mouse secondary antibodies. Cell nuclei were detected with Hoechst 33342. Merged pictures ( c , f ) show no TLR9 immunostaining in SGCs of DRG from sham-operated rat (arrows in c), while SGCs enveloping large-sized neuronal bodies in DRG from CSNT-operated rat displayed clear TLR9 immunofluorescence (arrows in f). Scale bars = 20 μm.

Double immunofluorescence staining for TLR9 and GS as a marker of satellite glial cells (SGCs). Sections of lumbar DRG ipsilateral (DRGL4i) to sham operation (Sham) and CSNT were immunostained with a mixture of rabbit polyclonal anti-TLR9 ( a , d ) and mouse monoclonal anti-GS ( b , e ) antibodies. Immunostaining was visualized with TRITC-conjugated donkey anti-rabbit and FITC-conjugated donkey anti-mouse secondary antibodies. Cell nuclei were detected with Hoechst 33342. Merged pictures ( c , f ) show no TLR9 immunostaining in SGCs of DRG from sham-operated rat (arrows in c), while SGCs enveloping large-sized neuronal bodies in DRG from CSNT-operated rat displayed clear TLR9 immunofluorescence (arrows in f). Scale bars = 20 μm.

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TLR9 Products

Required fields are marked with *

My Review for All TLR9 Products

Required fields are marked with *

0
cart-icon
0
compare icon