"PON1" Related Products

Expand

Recombinant Human PON1, His-tagged

Cat.No. : PON1-49H
Product Overview : Paraoxonase-1 Isoform Human Recombinant is expressed in E. coli having a molecular weight of 42.9 kDa and fused to a 4.5kDa amino terminal hexahistidine tag.
Description : Paraoxonase 1 also called Esterase-A is involved in the detoxification of organophosphate insecticides such as parathion. Paraoxonase 1 may also confer protection against coronary artery disease by destroying proinflammatory oxidized lipids present in oxidized low-density lipoproteins (LDLs).
Source : E. coli
Species : Human
Tag : His
Form : Sterile Filtered clear solution. PON1 is supplied in 20mM Tris-HCl pH 8.0 and 50% glycerol.
AA Sequence : MAKLIALTLLGMGLALFRNHQSSYQTRLNALREVQPVELPNCNLVKGIETGSEDLEILPNGLAFISSGLKYPGI KSFNPNSPGKILLMDLNEEDPTVLELGITGSKFDVSSFNPHGISTFTDEDNAMYLLVVNHPDAKSTVELFKFQEEEKSLLHLKTIRHKLLPNLNDIVAVGPEHFYGTNDHYFLDPYLRSWEMYLGLAWSYVVYYSPSEVRVVAEGFD FANGINISPDGKYVYIAELLAHKIHVYEKHANWTLTPLKSLDFNTLVDNISVDPETGDLWVGCHPNGMKIFFYDSENPPASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKALYCELZ.
Purity : Greater than 95% as determined by SDS-PAGE. Single band on Western Blot.
Applications : Arylesterase 1 can be used directly as a positive control in Western blotting, ELISA, immunoprecipitation and other immunological experiments. The biological activity of this product has not yet been tested.
Storage : Store at 4 centigrade if entire vial will be used within 1-2 weeks. Store, frozen at -20 centigrade for longer periods of time. Avoid multiple freeze-thaw cycles.
Gene Name : PON1 paraoxonase 1 [ Homo sapiens ]
Official Symbol : PON1
Synonyms : ESA; PON; MVCD5; serum paraoxonase/arylesterase 1; A-esterase 1; K-45; PON 1; aromatic esterase 1; arylesterase 1; arylesterase B-type; esterase A; paraoxonase B-type; serum aryldiakylphosphatase; serum aryldialkylphosphatase 1
Gene ID : 5444
mRNA Refseq : NM_000446
Protein Refseq : NP_000437
MIM : 168820
UniProt ID : P27169
Chromosome Location : 7q21.3
Pathway : Metabolic pathways, organism-specific biosystem; Phase I, non P450, organism-specific biosystem
Function : aryldialkylphosphatase activity; arylesterase activity; calcium ion binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.