Cat.No. : |
PON1-49H |
Product Overview : |
Paraoxonase-1 Isoform Human Recombinant is expressed in E. coli having a molecular weight of 42.9 kDa and fused to a 4.5kDa amino terminal hexahistidine tag. |
Description : |
Paraoxonase 1 also called Esterase-A is involved in the detoxification of organophosphate insecticides such as parathion. Paraoxonase 1 may also confer protection against coronary artery disease by destroying proinflammatory oxidized lipids present in oxidized low-density lipoproteins (LDLs). |
Source : |
E. coli |
Species : |
Human |
Tag : |
His |
Form : |
Sterile Filtered clear solution. PON1 is supplied in 20mM Tris-HCl pH 8.0 and 50% glycerol. |
AA Sequence : |
MAKLIALTLLGMGLALFRNHQSSYQTRLNALREVQPVELPNCNLVKGIETGSEDLEILPNGLAFISSGLKYPGI KSFNPNSPGKILLMDLNEEDPTVLELGITGSKFDVSSFNPHGISTFTDEDNAMYLLVVNHPDAKSTVELFKFQEEEKSLLHLKTIRHKLLPNLNDIVAVGPEHFYGTNDHYFLDPYLRSWEMYLGLAWSYVVYYSPSEVRVVAEGFD FANGINISPDGKYVYIAELLAHKIHVYEKHANWTLTPLKSLDFNTLVDNISVDPETGDLWVGCHPNGMKIFFYDSENPPASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKALYCELZ. |
Purity : |
Greater than 95% as determined by SDS-PAGE. Single band on Western Blot. |
Applications : |
Arylesterase 1 can be used directly as a positive control in Western blotting, ELISA, immunoprecipitation and other immunological experiments. The biological activity of this product has not yet been tested. |
Storage : |
Store at 4 centigrade if entire vial will be used within 1-2 weeks. Store, frozen at -20 centigrade for longer periods of time. Avoid multiple freeze-thaw cycles. |