| Cat.No.: | PON1-49H |
| Product Overview: | Paraoxonase-1 Isoform Human Recombinant is expressed in E. coli having a molecular weight of 42.9 kDa and fused to a 4.5kDa amino terminal hexahistidine tag. |
| Description: | Paraoxonase 1 also called Esterase-A is involved in the detoxification of organophosphate insecticides such as parathion. Paraoxonase 1 may also confer protection against coronary artery disease by destroying proinflammatory oxidized lipids present in oxidized low-density lipoproteins (LDLs). |
| Source: | E. coli |
| Species: | Human |
| Tag: | His |
| Form: | Sterile Filtered clear solution. PON1 is supplied in 20mM Tris-HCl pH 8.0 and 50% glycerol. |
| AA Sequence: | MAKLIALTLLGMGLALFRNHQSSYQTRLNALREVQPVELPNCNLVKGIETGSEDLEILPNGLAFISSGLKYPGI KSFNPNSPGKILLMDLNEEDPTVLELGITGSKFDVSSFNPHGISTFTDEDNAMYLLVVNHPDAKSTVELFKFQEEEKSLLHLKTIRHKLLPNLNDIVAVGPEHFYGTNDHYFLDPYLRSWEMYLGLAWSYVVYYSPSEVRVVAEGFD FANGINISPDGKYVYIAELLAHKIHVYEKHANWTLTPLKSLDFNTLVDNISVDPETGDLWVGCHPNGMKIFFYDSENPPASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKALYCELZ. |
| Purity: | Greater than 95% as determined by SDS-PAGE. Single band on Western Blot. |
| Applications: | Arylesterase 1 can be used directly as a positive control in Western blotting, ELISA, immunoprecipitation and other immunological experiments. The biological activity of this product has not yet been tested. |
| Storage: | Store at 4 centigrade if entire vial will be used within 1-2 weeks. Store, frozen at -20 centigrade for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Gene Name: | PON1 paraoxonase 1 [ Homo sapiens ] |
| Official Symbol: | PON1 |
| Synonyms: | ESA; PON; MVCD5; serum paraoxonase/arylesterase 1; A-esterase 1; K-45; PON 1; aromatic esterase 1; arylesterase 1; arylesterase B-type; esterase A; paraoxonase B-type; serum aryldiakylphosphatase; serum aryldialkylphosphatase 1 |
| Gene ID: | 5444 |
| mRNA Refseq: | NM_000446 |
| Protein Refseq: | NP_000437 |
| MIM: | 168820 |
| UniProt ID: | P27169 |
| Chromosome Location: | 7q21.3 |
| Pathway: | Metabolic pathways, organism-specific biosystem; Phase I, non P450, organism-specific biosystem |
| Function: | aryldialkylphosphatase activity; arylesterase activity; calcium ion binding |
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
Download Datasheet
See All PON1 Products
Download Datasheet