Cat.No. :	PON1-49H
Product Overview :	Paraoxonase-1 Isoform Human Recombinant is expressed in E. coli having a molecular weight of 42.9 kDa and fused to a 4.5kDa amino terminal hexahistidine tag.
Description :	Paraoxonase 1 also called Esterase-A is involved in the detoxification of organophosphate insecticides such as parathion. Paraoxonase 1 may also confer protection against coronary artery disease by destroying proinflammatory oxidized lipids present in oxidized low-density lipoproteins (LDLs).
Source :	E. coli
Species :	Human
Tag :	His
Form :	Sterile Filtered clear solution. PON1 is supplied in 20mM Tris-HCl pH 8.0 and 50% glycerol.
AA Sequence :	MAKLIALTLLGMGLALFRNHQSSYQTRLNALREVQPVELPNCNLVKGIETGSEDLEILPNGLAFISSGLKYPGI KSFNPNSPGKILLMDLNEEDPTVLELGITGSKFDVSSFNPHGISTFTDEDNAMYLLVVNHPDAKSTVELFKFQEEEKSLLHLKTIRHKLLPNLNDIVAVGPEHFYGTNDHYFLDPYLRSWEMYLGLAWSYVVYYSPSEVRVVAEGFD FANGINISPDGKYVYIAELLAHKIHVYEKHANWTLTPLKSLDFNTLVDNISVDPETGDLWVGCHPNGMKIFFYDSENPPASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKALYCELZ.
Purity :	Greater than 95% as determined by SDS-PAGE. Single band on Western Blot.
Applications :	Arylesterase 1 can be used directly as a positive control in Western blotting, ELISA, immunoprecipitation and other immunological experiments. The biological activity of this product has not yet been tested.
Storage :	Store at 4 centigrade if entire vial will be used within 1-2 weeks. Store, frozen at -20 centigrade for longer periods of time. Avoid multiple freeze-thaw cycles.

Gene Name :	PON1 paraoxonase 1 [ Homo sapiens ]
Official Symbol :	PON1
Synonyms :	ESA; PON; MVCD5; serum paraoxonase/arylesterase 1; A-esterase 1; K-45; PON 1; aromatic esterase 1; arylesterase 1; arylesterase B-type; esterase A; paraoxonase B-type; serum aryldiakylphosphatase; serum aryldialkylphosphatase 1
Gene ID :	5444
mRNA Refseq :	NM_000446
Protein Refseq :	NP_000437
MIM :	168820
UniProt ID :	P27169
Chromosome Location :	7q21.3
Pathway :	Metabolic pathways, organism-specific biosystem; Phase I, non P450, organism-specific biosystem
Function :	aryldialkylphosphatase activity; arylesterase activity; calcium ion binding

Online Inquiry