Recombinant Human PON1, His-tagged
Cat.No. : | PON1-49H |
Product Overview : | Paraoxonase-1 Isoform Human Recombinant is expressed in E. coli having a molecular weight of 42.9 kDa and fused to a 4.5kDa amino terminal hexahistidine tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 16-355 aa |
Description : | Paraoxonase 1 also called Esterase-A is involved in the detoxification of organophosphate insecticides such as parathion. Paraoxonase 1 may also confer protection against coronary artery disease by destroying proinflammatory oxidized lipids present in oxidized low-density lipoproteins (LDLs). |
Form : | Sterile Filtered clear solution. PON1 is supplied in 20mM Tris-HCl pH 8.0 and 50% glycerol. |
AA Sequence : | MAKLIALTLLGMGLALFRNHQSSYQTRLNALREVQPVELPNCNLVKGIETGSEDLEILPNGLAFISSGLKYPGI KSFNPNSPGKILLMDLNEEDPTVLELGITGSKFDVSSFNPHGISTFTDEDNAMYLLVVNHPDAKSTVELFKFQEEEKSLLHLKTIRHKLLPNLNDIVAVGPEHFYGTNDHYFLDPYLRSWEMYLGLAWSYVVYYSPSEVRVVAEGFD FANGINISPDGKYVYIAELLAHKIHVYEKHANWTLTPLKSLDFNTLVDNISVDPETGDLWVGCHPNGMKIFFYDSENPPASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKALYCELZ. |
Purity : | Greater than 95% as determined by SDS-PAGE. Single band on Western Blot. |
Applications : | Arylesterase 1 can be used directly as a positive control in Western blotting, ELISA, immunoprecipitation and other immunological experiments. The biological activity of this product has not yet been tested. |
Storage : | Store at 4 centigrade if entire vial will be used within 1-2 weeks. Store, frozen at -20 centigrade for longer periods of time. Avoid multiple freeze-thaw cycles. |
Gene Name | PON1 paraoxonase 1 [ Homo sapiens ] |
Official Symbol | PON1 |
Synonyms | ESA; PON; MVCD5; serum paraoxonase/arylesterase 1; A-esterase 1; K-45; PON 1; aromatic esterase 1; arylesterase 1; arylesterase B-type; esterase A; paraoxonase B-type; serum aryldiakylphosphatase; serum aryldialkylphosphatase 1 |
Gene ID | 5444 |
mRNA Refseq | NM_000446 |
Protein Refseq | NP_000437 |
MIM | 168820 |
UniProt ID | P27169 |
Chromosome Location | 7q21.3 |
Pathway | Metabolic pathways, organism-specific biosystem; Phase I, non P450, organism-specific biosystem |
Function | aryldialkylphosphatase activity; arylesterase activity; calcium ion binding |
◆ Recombinant Proteins | ||
PON1-3306R | Recombinant Rat PON1 protein, His-tagged | +Inquiry |
Pon1-293M | Recombinant Mouse Pon1 Protein, His-tagged | +Inquiry |
PON1-3301H | Recombinant Human PON1 protein, His-tagged | +Inquiry |
PON1-499HFL | Recombinant Full Length Human PON1 Protein, C-Flag-tagged | +Inquiry |
PON1-6940M | Recombinant Mouse PON1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PON1-3014HCL | Recombinant Human PON1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PON1 Products
Required fields are marked with *
My Review for All PON1 Products
Required fields are marked with *