- Bacillus subtilis(1)
- Human(10)
- Rat(1)
- Rhesus Macaque(1)
Recombinant Human CSTA protein
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
| Cat.No. : | CSTA-213H |
| Product Overview : |
Recombinant Human Cystatin A is produced with our E. coli ex |
| Source : | E.coli |
| Species : | Human |
| Tag : | His |
| Form : | Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, 100mM NaCl, pH 8.0. |
| AA Sequence : | MHHHHHHIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKV FKSLPGQNEDLVLTGYQVDKNKDDELTGF |
| Endotoxin : | < 1.0 EU per μg of the protein as determined by the LAL method. |
| Purity : | > 95 % as determined by SDS-PAGE. |
| Stability : | Samples are stable for up to twelve months from date of receipt at -70 centigrade. |
| Storage : | Store it under sterile conditions at -20℃~-70℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4oC before opening to recover the entire contents. |
| Gene Name : | CSTA cystatin A [ Homo sapiens ] |
| Official Symbol : | CSTA |
| Synonyms : | AREI; STF1; STFA; cystatin A (stefin A); cystatin AS |
| Gene ID : | 1475 |
| mRNA Refseq : | NM_005213 |
| Protein Refseq : | NP_005204 |
| MIM : | 184600 |
| UniProt ID : | P01040 |
| Chromosome Location : | 3q21 |
| Function : | cysteine-type endopeptidase inhibitor activity; protease binding; structural molecule activity |
◆ Recombinant Protein
| CSTA-2014H | Recombinant Human CSTA Protein, His-tagged | +Inquiry |
| CSTA-2037H | Recombinant Human CSTA Protein, GST-tagged | +Inquiry |
| CSTA-3489H | Recombinant Human Cystatin A, His-tagged | +Inquiry |
| CSTA-226H | Recombinant Human CSTA Protein, His-tagged | +Inquiry |
| CSTA-1069R | Recombinant Rhesus monkey CSTA Protein, His-tagged | +Inquiry |
|
|
◆ Lysates
| CSTA-7225HCL | Recombinant Human CSTA 293 Cell Lysate | +Inquiry |
|
|
Easy access to products and services you need from our library via powerful searching tools.
Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy
