Expand Expand| Cat.No. : | CSTA-213H |
| Product Overview : | Recombinant Human Cystatin A is produced with our E. coli ex |
| Source : | E.coli |
| Species : | Human |
| Tag : | His |
| Form : | Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, 100mM NaCl, pH 8.0. |
| AA Sequence : | MHHHHHHIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKV FKSLPGQNEDLVLTGYQVDKNKDDELTGF |
| Endotoxin : | < 1.0 EU per μg of the protein as determined by the LAL method. |
| Purity : | > 95 % as determined by SDS-PAGE. |
| Stability : | Samples are stable for up to twelve months from date of receipt at -70 centigrade. |
| Storage : | Store it under sterile conditions at -20℃~-70℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4oC before opening to recover the entire contents. |
| Gene Name : | CSTA cystatin A [ Homo sapiens ] |
| Official Symbol : | CSTA |
| Synonyms : | AREI; STF1; STFA; cystatin A (stefin A); cystatin AS |
| Gene ID : | 1475 |
| mRNA Refseq : | NM_005213 |
| Protein Refseq : | NP_005204 |
| MIM : | 184600 |
| UniProt ID : | P01040 |
| Chromosome Location : | 3q21 |
| Function : | cysteine-type endopeptidase inhibitor activity; protease binding; structural molecule activity |
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
Download Datasheet
See All CSTA Products
Download Datasheet