Cat.No.:	CSTA-213H
Product Overview:	Recombinant Human Cystatin A is produced with our E. coli expression system. The target protein is expressed with sequence (Ile2-Phe98) of Human Cystatin A.
Source:	E.coli
Species:	Human
Tag:	His
Form:	Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, 100mM NaCl, pH 8.0.
AA Sequence:	MHHHHHHIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKV FKSLPGQNEDLVLTGYQVDKNKDDELTGF
Endotoxin:	< 1.0 EU per μg of the protein as determined by the LAL method.
Purity:	> 95 % as determined by SDS-PAGE.
Stability:	Samples are stable for up to twelve months from date of receipt at -70 centigrade.
Storage:	Store it under sterile conditions at -20℃~-70℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Reconstitution:	It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4oC before opening to recover the entire contents.

Gene Name:	CSTA cystatin A [ Homo sapiens ]
Official Symbol:	CSTA
Synonyms:	AREI; STF1; STFA; cystatin A (stefin A); cystatin AS
Gene ID:	1475
mRNA Refseq:	NM_005213
Protein Refseq:	NP_005204
MIM:	184600
UniProt ID:	P01040
Chromosome Location:	3q21
Function:	cysteine-type endopeptidase inhibitor activity; protease binding; structural molecule activity

Online Inquiry