"CSTA" Related Products

Expand

Recombinant Human CSTA protein

Cat.No. : CSTA-213H
Product Overview : Recombinant Human Cystatin A is produced with our E. coli expression system. The target protein is expressed with sequence (Ile2-Phe98) of Human Cystatin A.
Source : E.coli
Species : Human
Tag : His
Form : Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, 100mM NaCl, pH 8.0.
AA Sequence : MHHHHHHIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKV FKSLPGQNEDLVLTGYQVDKNKDDELTGF
Endotoxin : < 1.0 EU per μg of the protein as determined by the LAL method.
Purity : > 95 % as determined by SDS-PAGE.
Stability : Samples are stable for up to twelve months from date of receipt at -70 centigrade.
Storage : Store it under sterile conditions at -20℃~-70℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4oC before opening to recover the entire contents.
Gene Name : CSTA cystatin A [ Homo sapiens ]
Official Symbol : CSTA
Synonyms : AREI; STF1; STFA; cystatin A (stefin A); cystatin AS
Gene ID : 1475
mRNA Refseq : NM_005213
Protein Refseq : NP_005204
MIM : 184600
UniProt ID : P01040
Chromosome Location : 3q21
Function : cysteine-type endopeptidase inhibitor activity; protease binding; structural molecule activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.