Cat.No. : |
CSTA-213H |
Product Overview : |
Recombinant Human Cystatin A is produced with our E. coli expression system. The target protein is expressed with sequence (Ile2-Phe98) of Human Cystatin A. |
Source : |
E.coli |
Species : |
Human |
Tag : |
His |
Form : |
Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, 100mM NaCl, pH 8.0. |
AA Sequence : |
MHHHHHHIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKV FKSLPGQNEDLVLTGYQVDKNKDDELTGF |
Endotoxin : |
< 1.0 EU per μg of the protein as determined by the LAL method. |
Purity : |
> 95 % as determined by SDS-PAGE. |
Stability : |
Samples are stable for up to twelve months from date of receipt at -70 centigrade. |
Storage : |
Store it under sterile conditions at -20℃~-70℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Reconstitution : |
It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4oC before opening to recover the entire contents. |