Recombinant Human PIGF
Cat.No. : | PIGF-456H |
Product Overview : | Recombinant Human Placental growth Factor was expressed in modifiedhuman 293 cells. |
- Specification
- Gene Information
- Related Products
Cat. No. : | PIGF-456H |
Description : | PlGF (Placental growth Factor) was isolated initially as a cDNA from a human placenta cDNA library. PlGF is expressed also in human umbilical vein endothelial cells colon and mammary carcinomas. Placenta growth factor (PlGF) is a member of the vascular endothelial growth factor (VEGF) family of growth factors. PlGF and VEGF share primary structural as well as limited amino acid sequence homology with the A and B chains of PDGF. The biologically active form of this protein is a disulfide-linked dimer. The N-glycosylated dimeric protein is secreted and stimulates the proliferation of endothelial cell lines and supports angiogenesis. |
Source : | human 293 cells. |
Theoretical Sequence : | MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWG RSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPV ETAN VT MQLL KIRSG DRPS YVELTFSQHVRCECRPLREKMKPERCGD AVPRR. |
Molecular Mass : | PlGF migrates as two broad bands between 17 and 30 kDa on SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with the unmodified PLGF that has a predicted molecular mass of 16.7kDa. |
PI : | PlGF separates into a number of glycoforms with varying pI values on 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified PLGF that has a predicted pI of 6.3. |
% Carbohydrate : | purified PlGF consists of 0-38% carbohydrate by weight. |
Glycosylation : | PlGF has N-linked and O-linked oligosaccharides. |
Purity : | >95%, as determined by SDS-PAGE and visualized by Coomassie Brilliant Blue. |
Formulation : | When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose. |
Reconstitution : | It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. |
Storage : | Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. |
Gene Name : | PIGF phosphatidylinositol glycan anchor biosynthesis, class F [ Homo sapiens ] |
Synonyms : | phosphatidylinositol glycan anchor biosynthesis, class F; MGC32646; MGC33136; PIGF; phosphatidylinositol glycan, class F; PIG-F; GPI11 homolog; OTTHUMP00000159031 |
Gene ID : | 5281 |
mRNA Refseq : | NM_002643 |
Protein Refseq : | NP_002634 |
MIM : | 600153 |
UniProt ID : | Q07326 |
Chromosome Location : | 2p21-p16 |
Pathway : | Glycosylphosphatidylinositol(GPI)-anchor biosynthesis; Metabolic pathways; Metabolism of proteins |
Function : | ethanolaminephosphotransferase activity; protein binding |
Products Types
◆ Recombinant Protein | ||
PIGF-3854H | Recombinant Human PIGF Protein, His (Fc)-Avi-tagged | +Inquiry |
PIGF-1123H | Active Recombinant Human PIGF Protein, Fc-tagged | +Inquiry |
PIGF-464H | Recombinant Human PIGF | +Inquiry |
Pigf-330M | Recombinant Mouse Pigf | +Inquiry |
PIGF-11676Z | Recombinant Zebrafish PIGF | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (5)
Ask a questionPIGF protein has various clinical applications in the fields of oncology, cardiology, and obstetrics.
In oncology, PIGF protein is used as a biomarker for certain types of cancer, aiding in diagnosis and prognosis.
Enzyme-linked immunosorbent assay (ELISA) and other immunoassay techniques are commonly used to measure PIGF protein levels.
Increased PIGF protein levels are often associated with tumor growth, invasion, and metastasis in various types of cancer.
PIGF protein levels are reduced in women with preeclampsia, and its dysregulation is associated with the development of the condition.
Customer Reviews (3)
Write a reviewIts impressive purity and functional properties make it an ideal choice for my research, ensuring precise and accurate results.
Their expertise and responsiveness exemplify their dedication to assisting customers, offering solutions and guidance whenever challenges arise.
The combination of the protein's exceptional characteristics and the manufacturer's outstanding technical assistance equips me with the necessary resources to overcome potential hurdles and achieve groundbreaking results.
Ask a Question for All PIGF Products
Required fields are marked with *
My Review for All PIGF Products
Required fields are marked with *
Inquiry Basket