Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human PIGF

Cat.No. : PIGF-456H
Product Overview : Recombinant Human Placental growth Factor was expressed in modifiedhuman 293 cells.
  • Specification
  • Gene Information
  • Related Products
Cat. No. : PIGF-456H
Description : PlGF (Placental growth Factor) was isolated initially as a cDNA from a human placenta cDNA library. PlGF is expressed also in human umbilical vein endothelial cells colon and mammary carcinomas. Placenta growth factor (PlGF) is a member of the vascular endothelial growth factor (VEGF) family of growth factors. PlGF and VEGF share primary structural as well as limited amino acid sequence homology with the A and B chains of PDGF. The biologically active form of this protein is a disulfide-linked dimer. The N-glycosylated dimeric protein is secreted and stimulates the proliferation of endothelial cell lines and supports angiogenesis.
Source : human 293 cells.
Theoretical Sequence : MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWG RSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPV ETAN VT MQLL KIRSG DRPS YVELTFSQHVRCECRPLREKMKPERCGD AVPRR.
Molecular Mass : PlGF migrates as two broad bands between 17 and 30 kDa on SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with the unmodified PLGF that has a predicted molecular mass of 16.7kDa.
PI : PlGF separates into a number of glycoforms with varying pI values on 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified PLGF that has a predicted pI of 6.3.
% Carbohydrate : purified PlGF consists of 0-38% carbohydrate by weight.
Glycosylation : PlGF has N-linked and O-linked oligosaccharides.
Purity : >95%, as determined by SDS-PAGE and visualized by Coomassie Brilliant Blue.
Formulation : When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution : It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage : Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C.
Gene Name : PIGF phosphatidylinositol glycan anchor biosynthesis, class F [ Homo sapiens ]
Synonyms : phosphatidylinositol glycan anchor biosynthesis, class F; MGC32646; MGC33136; PIGF; phosphatidylinositol glycan, class F; PIG-F; GPI11 homolog; OTTHUMP00000159031
Gene ID : 5281
mRNA Refseq : NM_002643
Protein Refseq : NP_002634
MIM : 600153
UniProt ID : Q07326
Chromosome Location : 2p21-p16
Pathway : Glycosylphosphatidylinositol(GPI)-anchor biosynthesis; Metabolic pathways; Metabolism of proteins
Function : ethanolaminephosphotransferase activity; protein binding

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (5)

Ask a question
What are the clinical applications of PIGF protein? 10/26/2021

PIGF protein has various clinical applications in the fields of oncology, cardiology, and obstetrics.

How is PIGF protein used in oncology? 10/03/2018

In oncology, PIGF protein is used as a biomarker for certain types of cancer, aiding in diagnosis and prognosis.

What are the methods used to measure PIGF protein levels in clinical settings? 08/02/2018

Enzyme-linked immunosorbent assay (ELISA) and other immunoassay techniques are commonly used to measure PIGF protein levels.

How are abnormal PIGF protein levels linked to cancer progression? 06/24/2017

Increased PIGF protein levels are often associated with tumor growth, invasion, and metastasis in various types of cancer.

How is PIGF protein involved in the pathophysiology of preeclampsia? 01/28/2016

PIGF protein levels are reduced in women with preeclampsia, and its dysregulation is associated with the development of the condition.

Customer Reviews (3)

Write a review
Reviews
12/17/2022

    Its impressive purity and functional properties make it an ideal choice for my research, ensuring precise and accurate results.

    08/18/2021

      Their expertise and responsiveness exemplify their dedication to assisting customers, offering solutions and guidance whenever challenges arise.

      08/27/2017

        The combination of the protein's exceptional characteristics and the manufacturer's outstanding technical assistance equips me with the necessary resources to overcome potential hurdles and achieve groundbreaking results.

        Ask a Question for All PIGF Products

        Required fields are marked with *

        My Review for All PIGF Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends