Recombinant Human PIGF

Name: Recombinant Human PIGF
SKU: PIGF-456H

Species :	Human
Source :	HEK293
Tag :	Non
Description :	PlGF (Placental growth Factor) was isolated initially as a cDNA from a human placenta cDNA library. PlGF is expressed also in human umbilical vein endothelial cells colon and mammary carcinomas. Placenta growth factor (PlGF) is a member of the vascular endothelial growth factor (VEGF) family of growth factors. PlGF and VEGF share primary structural as well as limited amino acid sequence homology with the A and B chains of PDGF. The biologically active form of this protein is a disulfide-linked dimer. The N-glycosylated dimeric protein is secreted and stimulates the proliferation of endothelial cell lines and supports angiogenesis.
Theoretical Sequence :	MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWG RSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPV ETAN VT MQLL KIRSG DRPS YVELTFSQHVRCECRPLREKMKPERCGD AVPRR.
Molecular Mass :	PlGF migrates as two broad bands between 17 and 30 kDa on SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with the unmodified PLGF that has a predicted molecular mass of 16.7kDa.
PI :	PlGF separates into a number of glycoforms with varying pI values on 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified PLGF that has a predicted pI of 6.3.
% Carbohydrate :	purified PlGF consists of 0-38% carbohydrate by weight.
Glycosylation :	PlGF has N-linked and O-linked oligosaccharides.
Purity :	>95%, as determined by SDS-PAGE and visualized by Coomassie Brilliant Blue.
Formulation :	When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution :	It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage :	Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C.

Gene Name	PIGF phosphatidylinositol glycan anchor biosynthesis, class F [ Homo sapiens ]
Synonyms	phosphatidylinositol glycan anchor biosynthesis, class F; MGC32646; MGC33136; PIGF; phosphatidylinositol glycan, class F; PIG-F; GPI11 homolog; OTTHUMP00000159031
Gene ID	5281
mRNA Refseq	NM_002643
Protein Refseq	NP_002634
MIM	600153
UniProt ID	Q07326
Chromosome Location	2p21-p16
Pathway	Glycosylphosphatidylinositol(GPI)-anchor biosynthesis; Metabolic pathways; Metabolism of proteins
Function	ethanolaminephosphotransferase activity; protein binding