Species : |
Human |
Source : |
HEK293 |
Tag : |
Non |
Description : |
PlGF (Placental growth Factor) was isolated initially as a cDNA from a human placenta cDNA library. PlGF is expressed also in human umbilical vein endothelial cells colon and mammary carcinomas. Placenta growth factor (PlGF) is a member of the vascular endothelial growth factor (VEGF) family of growth factors. PlGF and VEGF share primary structural as well as limited amino acid sequence homology with the A and B chains of PDGF. The biologically active form of this protein is a disulfide-linked dimer. The N-glycosylated dimeric protein is secreted and stimulates the proliferation of endothelial cell lines and supports angiogenesis. |
Theoretical Sequence : |
MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWG RSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPV ETAN VT MQLL KIRSG DRPS YVELTFSQHVRCECRPLREKMKPERCGD AVPRR. |
Molecular Mass : |
PlGF migrates as two broad bands between 17 and 30 kDa on SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with the unmodified PLGF that has a predicted molecular mass of 16.7kDa. |
PI : |
PlGF separates into a number of glycoforms with varying pI values on 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified PLGF that has a predicted pI of 6.3. |
% Carbohydrate : |
purified PlGF consists of 0-38% carbohydrate by weight. |
Glycosylation : |
PlGF has N-linked and O-linked oligosaccharides. |
Purity : |
>95%, as determined by SDS-PAGE and visualized by Coomassie Brilliant Blue. |
Formulation : |
When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose. |
Reconstitution : |
It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. |
Storage : |
Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. |