"II28A" Related Products

Recombinant Mouse II28A protein

Cat.No. : II28A-992M
Product Overview : Recombinant Mouse II28A protein was expressed in Escherichia coli.
Source : E.coli
Species : Mouse
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, with 5 % trehalose.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by an anti-viral assay using human HepG2 cells infected with encephalomyocarditis is less than 3 ng/ml, corresponding to a specific activity of > 3.3 × 10⁵ IU/mg.
Molecular Mass : Approximately 19.7 kDa, a single non-glycosylated polypeptide chain containing 174 amino acids.
Protein length : 174
AA Sequence : DPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKDAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENMTDSALATILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFRLLTRDLKCVASGDQCV
Endotoxin : Less than 0.1 EU/µg of rMuIFN-λ2/IL-28A as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
SDS-PAGE of II28A-992M :

Gene Name : II28A
Official Symbol : II28A
Gene ID : 330496
UniProt ID : Q4VK74

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.