Recombinant Mouse II28A protein
| Cat.No. : | II28A-992M |
| Product Overview : | Recombinant Mouse II28A protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 174 |
| Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, with 5 % trehalose. |
| Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by an anti-viral assay using human HepG2 cells infected with encephalomyocarditis is less than 3 ng/ml, corresponding to a specific activity of > 3.3 × 10⁵ IU/mg. |
| Molecular Mass : | Approximately 19.7 kDa, a single non-glycosylated polypeptide chain containing 174 amino acids. |
| AA Sequence : | DPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKDAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENMTDSALATILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFRLLTRDLKCVASGDQCV |
| Endotoxin : | Less than 0.1 EU/µg of rMuIFN-λ2/IL-28A as determined by LAL method. |
| Purity : | >95% by SDS-PAGE and HPLC analysis. |
| Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
| ◆ Recombinant Proteins | ||
| II28A-992M | Recombinant Mouse II28A protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All II28A Products
Required fields are marked with *
My Review for All II28A Products
Required fields are marked with *
