Recombinant Mouse II28A protein

• Cat.No.: II28A-992M
• Product Overview: Recombinant Mouse II28A protein was expressed in Escherichia coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 174
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, with 5 % trehalose.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by an anti-viral assay using human HepG2 cells infected with encephalomyocarditis is less than 3 ng/ml, corresponding to a specific activity of > 3.3 × 10⁵ IU/mg.
• Molecular Mass: Approximately 19.7 kDa, a single non-glycosylated polypeptide chain containing 174 amino acids.
• AA Sequence: DPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKDAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENMTDSALATILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFRLLTRDLKCVASGDQCV
• Endotoxin: Less than 0.1 EU/µg of rMuIFN-λ2/IL-28A as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: II28A
• Official Symbol: II28A
• Gene ID: 330496
• UniProt ID: Q4VK74