"A1BG" Related Products

Expand
Expand
Expand

Recombinant Human A1BG

Cat.No.: A1BG-26035TH
Product Overview: Recombinant full length Human A1BG Isoform 2 with N terminal proprietary tag; Predicted MW 67.14 kDa
Description: The protein encoded by this gene is a plasma glycoprotein of unknown function. The protein shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins.
Protein length: 373 amino acids
Molecular Weight: 67.140kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Plasma.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVP EAQEDVEATFPVHQPGNYSCSYRTDGEGALSEPSATVTIE ELAAPPPPVLMHHGESSQVLHPGNKVTLTCVAPLSGVDFQ LRRGEKELLVPRSSTSPDRIFFHLNAVALGDGGHYTCRYR LHDNQNGWSGDSAPVELILSDETLPAPEFSPEPESGRALR LRCLAPLEGARFALVREDRGGRRVHRFQSPAGTEALFELH NISVADSANYSCVYVDLKPPFGGSAPSERLELHVDGPPPR PQLRATWSGAVLAGRDAVLRCEGPIPDVTFELLREGETKA VKTVRTPGAAANLELIFVGPQHAGNYRCRYRSWVPHTFES ELSDPVELLVAES
Sequence Similarities: Contains 5 Ig-like V-type (immunoglobulin-like) domains.
Gene Name: A1BG alpha-1-B glycoprotein [ Homo sapiens ]
Official Symbol: A1BG
Synonyms: A1BG; alpha-1-B glycoprotein; alpha-1B-glycoprotein;
Gene ID: 1
mRNA Refseq: NM_130786
Protein Refseq: NP_570602
MIM: 138670
Uniprot ID: P04217
Chromosome Location: 19q
Function: molecular_function;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.