Recombinant Human A1BG

PRODUCTS

Home / Products / Antibody / Recombinant Human A1BG

Recombinant Human A1BG

A1BG Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : A1BG-26035TH
Product Overview : Recombinant full length Human A1BG Isoform 2 with N terminal proprietary tag; Predicted MW 67.14 kDa
Description : The protein encoded by this gene is a plasma glycoprotein of unknown function. The protein shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins.
Protein length : 373 amino acids
Molecular Weight : 67.140kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Plasma.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVP EAQEDVEATFPVHQPGNYSCSYRTDGEGALSEPSATVTIE ELAAPPPPVLMHHGESSQVLHPGNKVTLTCVAPLSGVDFQ LRRGEKELLVPRSSTSPDRIFFHLNAVALGDGGHYTCRYR LHDNQNGWSGDSAPVELILSDETLPAPEFSPEPESGRALR LRCLAPLEGARFALVREDRGGRRVHRFQSPAGTEALFELH NISVADSANYSCVYVDLKPPFGGSAPSERLELHVDGPPPR PQLRATWSGAVLAGRDAVLRCEGPIPDVTFELLREGETKA VKTVRTPGAAANLELIFVGPQHAGNYRCRYRSWVPHTFES ELSDPVELLVAES
Sequence Similarities : Contains 5 Ig-like V-type (immunoglobulin-like) domains.
Gene Name : A1BG alpha-1-B glycoprotein [ Homo sapiens ]
Official Symbol : A1BG
Synonyms : A1BG; alpha-1-B glycoprotein; alpha-1B-glycoprotein;
Gene ID : 1
mRNA Refseq : NM_130786
Protein Refseq : NP_570602
MIM : 138670
Uniprot ID : P04217
Chromosome Location : 19q
Function : molecular_function;

Online Inquiry


  •  
  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.