"ABCF3" Related Products

Expand

Recombinant Human ABCF3, His-tagged

Cat.No.: ABCF3-26042TH
Product Overview: Recombinant fragment, corresponding to amino acids 14-685 of Human ABCF3, with N terminal His tag, 672 amino acids, MWt 77.3kDa,
Description: ABCF3 belongs to the ABC transporter superfamily. ABCF family. EF3 subfamily. Contains 2 ABC transporter domains. There are 2 named isoforms produced by alternative splicing.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:reconstitution with 41 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: EIDGQVFDYVTGVLHSGSADFESVDDLVEAVGELLQEVSG DSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLLDAPI QLSKITENYDCGTKLPGLLKREQSSTVNAKKLEKAEARLK AKQEKRSEKDTLKTSNPLVLEEASASQAGSRKESRLES SGKNKSYDVRIENFDVSFGDRVLLAGADVNLAWGRRYGLV GRNGLGKTTLLKMLATRSLRVPAHISLLHVEQEVAGDD TPALQSVLESDSVREDLLRRERELTAQIAAGRAEGSEA AELAEIYAKLEEIEADKAPARASVILAGLGFTPKMQQQPT REFSGGWRMRLALARALFARPDLLLLDEPTNMLDVRAI LWLENYLQTWPSTILVVSHDRNFLNAIATDIIHLHSQRLD GYRGDFETFIKSKQERLLNQQREYEAQQQYRQHIQVFI DRFRYNANRASQVQSKLKMLEKLPELKPVDKESEVVMKFP DGFEKFSPPILQLDEVDFYYDPKHVIFSRLSVSADLES RICVVGENGAGKSTMLKLLLGDLAPVRGIRHAHRNLKI GYFSQHHVEQLDLNVSAVELLARKFPGRPEEEYRHQLGRY GISGELAMRPLASLSGGQKSRVAFAQMTMPCPNFYILD EPTNHLDMETIEALGRALNNFRGGVILVSHDERFIRLVCR ELWVCEGGGV
Gene Name: ABCF3 ATP-binding cassette, sub-family F (GCN20), member 3 [ Homo sapiens ]
Official Symbol: ABCF3
Synonyms: ABCF3; ATP-binding cassette, sub-family F (GCN20), member 3; ATP-binding cassette sub-family F member 3; EST201864;
Gene ID: 55324
mRNA Refseq: NM_018358
Protein Refseq: NP_060828
Uniprot ID: Q9NUQ8
Chromosome Location: 3q25.1-q25.2
Function: ATP binding; ATPase activity; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.