"ABCF3" Related Products

Expand

Recombinant Human ABCF3, His-tagged

Cat.No.: ABCF3-26042TH
Product Overview: Recombinant fragment, corresponding to amino acids 14-685 of Human ABCF3, with N terminal His tag, 672 amino acids, MWt 77.3kDa,
Description: ABCF3 belongs to the ABC transporter superfamily. ABCF family. EF3 subfamily. Contains 2 ABC transporter domains. There are 2 named isoforms produced by alternative splicing.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:reconstitution with 41 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: EIDGQVFDYVTGVLHSGSADFESVDDLVEAVGELLQEVSG DSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLLDAPI QLSKITENYDCGTKLPGLLKREQSSTVNAKKLEKAEARLK AKQEKRSEKDTLKTSNPLVLEEASASQAGSRKESRLES SGKNKSYDVRIENFDVSFGDRVLLAGADVNLAWGRRYGLV GRNGLGKTTLLKMLATRSLRVPAHISLLHVEQEVAGDD TPALQSVLESDSVREDLLRRERELTAQIAAGRAEGSEA AELAEIYAKLEEIEADKAPARASVILAGLGFTPKMQQQPT REFSGGWRMRLALARALFARPDLLLLDEPTNMLDVRAI LWLENYLQTWPSTILVVSHDRNFLNAIATDIIHLHSQRLD GYRGDFETFIKSKQERLLNQQREYEAQQQYRQHIQVFI DRFRYNANRASQVQSKLKMLEKLPELKPVDKESEVVMKFP DGFEKFSPPILQLDEVDFYYDPKHVIFSRLSVSADLES RICVVGENGAGKSTMLKLLLGDLAPVRGIRHAHRNLKI GYFSQHHVEQLDLNVSAVELLARKFPGRPEEEYRHQLGRY GISGELAMRPLASLSGGQKSRVAFAQMTMPCPNFYILD EPTNHLDMETIEALGRALNNFRGGVILVSHDERFIRLVCR ELWVCEGGGV
Gene Name: ABCF3 ATP-binding cassette, sub-family F (GCN20), member 3 [ Homo sapiens ]
Official Symbol: ABCF3
Synonyms: ABCF3; ATP-binding cassette, sub-family F (GCN20), member 3; ATP-binding cassette sub-family F member 3; EST201864;
Gene ID: 55324
mRNA Refseq: NM_018358
Protein Refseq: NP_060828
Uniprot ID: Q9NUQ8
Chromosome Location: 3q25.1-q25.2
Function: ATP binding; ATPase activity; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.