"ACTR1A" Related Products

Expand
Expand

Recombinant Human ACTR1A, His-tagged

Cat.No.: ACTR1A-26591TH
Product Overview: Recombinant fragment, corresponding to amino acids 97-376 of Human ACTR1A with an N terminal His tag. Predicted MWt: 33 kDa
Description: This gene encodes a 42.6 kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 125 μl distilled water.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: DQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPA LFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGF AMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFE IVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDL RRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKI RISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEED GARSIHRKTF
Gene Name: ACTR1A ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) [ Homo sapiens ]
Official Symbol: ACTR1A
Synonyms: ACTR1A; ARP1 actin-related protein 1 homolog A, centractin alpha (yeast); ARP1 (actin related protein 1, yeast) homolog A (centractin alpha); alpha-centractin; ARP1;
Gene ID: 10121
mRNA Refseq: NM_005736
Protein Refseq: NP_005727
MIM: 605143
Uniprot ID: P61163
Chromosome Location: 10q24
Pathway: Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem; G2/M Transition, organism-specific biosystem; Loss of Nlp from mitotic centrosomes, organism-specific biosystem; Loss of proteins required for interphase microtubule organization??from the centrosome, organism-specific biosystem;
Function: ATP binding; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.