"ACTR1B" Related Products

Expand

Recombinant Human ACTR1B, His-tagged

Cat.No.: ACTR1B-26592TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-376 of Human ACTR1B with N terminal His tag, 46kDa.
Description: This gene encodes a 42.3 kD subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein and is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit, like ACTR1A, is an actin-related protein. These two proteins, which are of equal length and share 90% amino acid identity, are present in a constant ratio of approximately 1:15 in the dynactin complex.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 84 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MESYDIIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVG RPKHMRVMAGALEGDLFIGPKAEEHRGLLTIRYPMEHG VVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLN PSKNREKAAEVFFETFNVPALFISMQAVLSLYATGRTTGV VLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVSRYL RLLLRKEGVDFHTSAEFEVVRTIKERACYLSINPQKDE ALETEKVQYTLPDGSTLDVGPARFRAPELLFQPDLVGDES EGLHEVVAFAIHKSDMDLRRTLFANIVLSGGSTLFKGF GDRLLSEVKKLAPKDIKIKISAPQERLYSTWIGGSILA SLDTFKKMWVSKKEYEEDGSRAIHRKTF
Sequence Similarities: Belongs to the actin family. ARP1 subfamily.
Gene Name: ACTR1B ARP1 actin-related protein 1 homolog B, centractin beta (yeast) [ Homo sapiens ]
Official Symbol: ACTR1B
Synonyms: ACTR1B; ARP1 actin-related protein 1 homolog B, centractin beta (yeast); ARP1 (actin related protein 1, yeast) homolog B (centractin beta) , CTRN2; beta-centractin;
Gene ID: 10120
mRNA Refseq: NM_005735
Protein Refseq: NP_005726
MIM: 605144
Uniprot ID: P42025
Chromosome Location: 2q11.1-q11.2
Function: ATP binding; nucleotide binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.