"ACTR1B" Related Products

Expand

Recombinant Human ACTR1B, His-tagged

Cat.No.: ACTR1B-26592TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-376 of Human ACTR1B with N terminal His tag, 46kDa.
Description: This gene encodes a 42.3 kD subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein and is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit, like ACTR1A, is an actin-related protein. These two proteins, which are of equal length and share 90% amino acid identity, are present in a constant ratio of approximately 1:15 in the dynactin complex.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 84 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MESYDIIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVG RPKHMRVMAGALEGDLFIGPKAEEHRGLLTIRYPMEHG VVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLN PSKNREKAAEVFFETFNVPALFISMQAVLSLYATGRTTGV VLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVSRYL RLLLRKEGVDFHTSAEFEVVRTIKERACYLSINPQKDE ALETEKVQYTLPDGSTLDVGPARFRAPELLFQPDLVGDES EGLHEVVAFAIHKSDMDLRRTLFANIVLSGGSTLFKGF GDRLLSEVKKLAPKDIKIKISAPQERLYSTWIGGSILA SLDTFKKMWVSKKEYEEDGSRAIHRKTF
Sequence Similarities: Belongs to the actin family. ARP1 subfamily.
Gene Name: ACTR1B ARP1 actin-related protein 1 homolog B, centractin beta (yeast) [ Homo sapiens ]
Official Symbol: ACTR1B
Synonyms: ACTR1B; ARP1 actin-related protein 1 homolog B, centractin beta (yeast); ARP1 (actin related protein 1, yeast) homolog B (centractin beta) , CTRN2; beta-centractin;
Gene ID: 10120
mRNA Refseq: NM_005735
Protein Refseq: NP_005726
MIM: 605144
Uniprot ID: P42025
Chromosome Location: 2q11.1-q11.2
Function: ATP binding; nucleotide binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.