Recombinant Human ACTR1B, His-tagged
Cat.No. : | ACTR1B-26592TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-376 of Human ACTR1B with N terminal His tag, 46kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-376 a.a. |
Description : | This gene encodes a 42.3 kD subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein and is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit, like ACTR1A, is an actin-related protein. These two proteins, which are of equal length and share 90% amino acid identity, are present in a constant ratio of approximately 1:15 in the dynactin complex. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 84 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MESYDIIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVG RPKHMRVMAGALEGDLFIGPKAEEHRGLLTIRYPMEHG VVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLN PSKNREKAAEVFFETFNVPALFISMQAVLSLYATGRTTGV VLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVSRYL RLLLRKEGVDFHTSAEFEVVRTIKERACYLSINPQKDE ALETEKVQYTLPDGSTLDVGPARFRAPELLFQPDLVGDES EGLHEVVAFAIHKSDMDLRRTLFANIVLSGGSTLFKGF GDRLLSEVKKLAPKDIKIKISAPQERLYSTWIGGSILA SLDTFKKMWVSKKEYEEDGSRAIHRKTF |
Sequence Similarities : | Belongs to the actin family. ARP1 subfamily. |
Full Length : | Full L. |
Gene Name | ACTR1B ARP1 actin-related protein 1 homolog B, centractin beta (yeast) [ Homo sapiens ] |
Official Symbol | ACTR1B |
Synonyms | ACTR1B; ARP1 actin-related protein 1 homolog B, centractin beta (yeast); ARP1 (actin related protein 1, yeast) homolog B (centractin beta) , CTRN2; beta-centractin; |
Gene ID | 10120 |
mRNA Refseq | NM_005735 |
Protein Refseq | NP_005726 |
MIM | 605144 |
Uniprot ID | P42025 |
Chromosome Location | 2q11.1-q11.2 |
Function | ATP binding; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
ACTR1B-55R | Recombinant Rhesus Macaque ACTR1B Protein, His (Fc)-Avi-tagged | +Inquiry |
ACTR1B-227R | Recombinant Rhesus monkey ACTR1B Protein, His-tagged | +Inquiry |
ACTR1B-26592TH | Recombinant Human ACTR1B, His-tagged | +Inquiry |
ACTR1B-293M | Recombinant Mouse ACTR1B Protein, His (Fc)-Avi-tagged | +Inquiry |
ACTR1B-151H | Recombinant Human ACTR1B Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTR1B-9052HCL | Recombinant Human ACTR1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACTR1B Products
Required fields are marked with *
My Review for All ACTR1B Products
Required fields are marked with *
0
Inquiry Basket