Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human ADM

Cat.No. : ADM-27104TH
Product Overview : Recombinant fragment of Human Adrenomedullin with N terminal proprietary tag, 37.73kDa.
  • Specification
  • Gene Information
  • Related Products
Description : Adrenomedullin, a hypotensive peptide found in human pheochromocytoma, consists of 52 amino acids, has 1 intramolecular disulfide bond, and shows a slight homology with the calcitonin gene-related peptide. It may function as a hormone in circulation control because it is found in blood in a considerable concentration. The precursor, called preproadrenomedullin, is 185 amino acids long. By RNA-blot analysis, human adrenomedullin mRNA was found to be highly expressed in several tissues. Genomic ADM DNA consists of 4 exons and 3 introns, with the 5-prime flanking region containing TATA, CAAT, and GC boxes. There are also multiple binding sites for activator protein-2 and a cAMP-regulated enhancer element.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Highest levels found in pheochromocytoma and adrenal medulla. Also found in lung, ventricle and kidney tissues.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKA GPAQTLIRPQDMKGASRSPEDSSPDAARIRVKRYRQSMNN FQGLRSFGCRFGTCTVQKLAHQIYQFTDKD
Sequence Similarities : Belongs to the adrenomedullin family.
Gene Name : ADM adrenomedullin [ Homo sapiens ]
Official Symbol : ADM
Synonyms : ADM; adrenomedullin; AM;
Gene ID : 133
mRNA Refseq : NM_001124
Protein Refseq : NP_001115
MIM : 103275
Uniprot ID : P35318
Chromosome Location : 11
Pathway : Calcitonin-like ligand receptors, organism-specific biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem;
Function : adrenomedullin receptor binding; hormone activity; receptor binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends