"ADM" Related Products

Expand
Expand

Recombinant Human ADM

Cat.No.: ADM-27104TH
Product Overview: Recombinant fragment of Human Adrenomedullin with N terminal proprietary tag, 37.73kDa.
Description: Adrenomedullin, a hypotensive peptide found in human pheochromocytoma, consists of 52 amino acids, has 1 intramolecular disulfide bond, and shows a slight homology with the calcitonin gene-related peptide. It may function as a hormone in circulation control because it is found in blood in a considerable concentration. The precursor, called preproadrenomedullin, is 185 amino acids long. By RNA-blot analysis, human adrenomedullin mRNA was found to be highly expressed in several tissues. Genomic ADM DNA consists of 4 exons and 3 introns, with the 5-prime flanking region containing TATA, CAAT, and GC boxes. There are also multiple binding sites for activator protein-2 and a cAMP-regulated enhancer element.
Protein length: 110 amino acids
Molecular Weight: 37.730kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Highest levels found in pheochromocytoma and adrenal medulla. Also found in lung, ventricle and kidney tissues.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: ARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKA GPAQTLIRPQDMKGASRSPEDSSPDAARIRVKRYRQSMNN FQGLRSFGCRFGTCTVQKLAHQIYQFTDKD
Sequence Similarities: Belongs to the adrenomedullin family.
Gene Name: ADM adrenomedullin [ Homo sapiens ]
Official Symbol: ADM
Synonyms: ADM; adrenomedullin; AM;
Gene ID: 133
mRNA Refseq: NM_001124
Protein Refseq: NP_001115
MIM: 103275
Uniprot ID: P35318
Chromosome Location: 11
Pathway: Calcitonin-like ligand receptors, organism-specific biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem;
Function: adrenomedullin receptor binding; hormone activity; receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.