Recombinant Human ADM Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ADM-856H |
Product Overview : | ADM MS Standard C13 and N15-labeled recombinant protein (NP_001115) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a preprohormone which is cleaved to form two biologically active peptides, adrenomedullin and proadrenomedullin N-terminal 20 peptide. Adrenomedullin is a 52 aa peptide with several functions, including vasodilation, regulation of hormone secretion, promotion of angiogenesis, and antimicrobial activity. The antimicrobial activity is antibacterial, as the peptide has been shown to kill E. coli and S. aureus at low concentration. |
Molecular Mass : | 20.4 kDa |
AA Sequence : | MKLVSVALMYLGSLAFLGADTARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRSPEDSSPDAARIRVKRYRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGYGRRRRRSLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ADM adrenomedullin [ Homo sapiens (human) ] |
Official Symbol | ADM |
Synonyms | ADM; adrenomedullin; AM; preproadrenomedullin; |
Gene ID | 133 |
mRNA Refseq | NM_001124 |
Protein Refseq | NP_001115 |
MIM | 103275 |
UniProt ID | P35318 |
◆ Recombinant Proteins | ||
Adm-3202M | Recombinant Mouse Adm, GST-tagged | +Inquiry |
Adm-545M | Recombinant Mouse Adm Protein, MYC/DDK-tagged | +Inquiry |
ADM-948HF | Recombinant Full Length Human ADM Protein, GST-tagged | +Inquiry |
ADM-530R | Recombinant Rat ADM Protein | +Inquiry |
Adm-234M | Recombinant Mouse Adm Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADM-1530HCL | Recombinant Human ADM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADM Products
Required fields are marked with *
My Review for All ADM Products
Required fields are marked with *