"AFG3L2" Related Products

Expand

Recombinant Human AFG3L2, His-tagged

Cat.No.: AFG3L2-26445TH
Product Overview: Recombinant fragment, corresponding to amino acids 5-169 of Human AFG3L2 with an N terminal His tag. Predicted MWt: 19 kDa;
Description: This gene encodes a protein localized in mitochondria and closely related to paraplegin. The paraplegin gene is responsible for an autosomal recessive form of hereditary spastic paraplegia. This gene is a candidate gene for other hereditary spastic paraplegias or neurodegenerative disorders.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 148 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: CLRLWGRGGCWPRGLQQLLVPGGVGPGEQPCLRTLYRFVT TQARASRNSLLTDIIAAYQRFCSRPPKGFGKYFPNGKN GKKASEPKEVMGEKKESKPAATTRSSGGGGGGGGKRGG KKDDSHWWSRFQKGDIPWDDKDFRMFFLWTALFWGGVMFYLLLKRSGRE
Gene Name: AFG3L2 AFG3 ATPase family gene 3-like 2 (S. cerevisiae) [ Homo sapiens ]
Official Symbol: AFG3L2
Synonyms: AFG3L2; AFG3 ATPase family gene 3-like 2 (S. cerevisiae); AFG3 (ATPase family gene 3, yeast) like 2 , AFG3 ATPase family gene 3 like 2 (yeast) , SCA28, spinocerebellar ataxia 28; AFG3-like protein 2;
Gene ID: 10939
mRNA Refseq: NM_006796
Protein Refseq: NP_006787
MIM: 604581
Uniprot ID: Q9Y4W6
Chromosome Location: 18p11.21
Function: ATP binding; metal ion binding; metalloendopeptidase activity; nucleoside-triphosphatase activity; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.