Recombinant Human AFG3L2, His-tagged

• Cat.No.: AFG3L2-26445TH
• Product Overview: Recombinant fragment, corresponding to amino acids 5-169 of Human AFG3L2 with an N terminal His tag. Predicted MWt: 19 kDa

Specification

• Description: This gene encodes a protein localized in mitochondria and closely related to paraplegin. The paraplegin gene is responsible for an autosomal recessive form of hereditary spastic paraplegia. This gene is a candidate gene for other hereditary spastic paraplegias or neurodegenerative disorders.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 148 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: CLRLWGRGGCWPRGLQQLLVPGGVGPGEQPCLRTLYRFVT TQARASRNSLLTDIIAAYQRFCSRPPKGFGKYFPNGKN GKKASEPKEVMGEKKESKPAATTRSSGGGGGGGGKRGG KKDDSHWWSRFQKGDIPWDDKDFRMFFLWTALFWGGVMFYLLLKRSGRE

Gene Information

• Gene Name: AFG3L2 AFG3 ATPase family gene 3-like 2 (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: AFG3L2
• Synonyms: AFG3L2; AFG3 ATPase family gene 3-like 2 (S. cerevisiae); AFG3 (ATPase family gene 3, yeast) like 2 , AFG3 ATPase family gene 3 like 2 (yeast) , SCA28, spinocerebellar ataxia 28; AFG3-like protein 2
• Gene ID: 10939
• mRNA Refseq: NM_006796
• Protein Refseq: NP_006787
• MIM: 604581
• Uniprot ID: Q9Y4W6
• Chromosome Location: 18p11.21
• Function: ATP binding; metal ion binding; metalloendopeptidase activity; nucleoside-triphosphatase activity; nucleotide binding