"AFG3L2" Related Products

Expand

Recombinant Human AFG3L2, His-tagged

Cat.No.: AFG3L2-26445TH
Product Overview: Recombinant fragment, corresponding to amino acids 5-169 of Human AFG3L2 with an N terminal His tag. Predicted MWt: 19 kDa;
Description: This gene encodes a protein localized in mitochondria and closely related to paraplegin. The paraplegin gene is responsible for an autosomal recessive form of hereditary spastic paraplegia. This gene is a candidate gene for other hereditary spastic paraplegias or neurodegenerative disorders.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 148 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: CLRLWGRGGCWPRGLQQLLVPGGVGPGEQPCLRTLYRFVT TQARASRNSLLTDIIAAYQRFCSRPPKGFGKYFPNGKN GKKASEPKEVMGEKKESKPAATTRSSGGGGGGGGKRGG KKDDSHWWSRFQKGDIPWDDKDFRMFFLWTALFWGGVMFYLLLKRSGRE
Gene Name: AFG3L2 AFG3 ATPase family gene 3-like 2 (S. cerevisiae) [ Homo sapiens ]
Official Symbol: AFG3L2
Synonyms: AFG3L2; AFG3 ATPase family gene 3-like 2 (S. cerevisiae); AFG3 (ATPase family gene 3, yeast) like 2 , AFG3 ATPase family gene 3 like 2 (yeast) , SCA28, spinocerebellar ataxia 28; AFG3-like protein 2;
Gene ID: 10939
mRNA Refseq: NM_006796
Protein Refseq: NP_006787
MIM: 604581
Uniprot ID: Q9Y4W6
Chromosome Location: 18p11.21
Function: ATP binding; metal ion binding; metalloendopeptidase activity; nucleoside-triphosphatase activity; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.