Recombinant Human AFG3L2, His-tagged
| Cat.No. : | AFG3L2-26445TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 5-169 of Human AFG3L2 with an N terminal His tag. Predicted MWt: 19 kDa; |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 5-169 a.a. |
| Description : | This gene encodes a protein localized in mitochondria and closely related to paraplegin. The paraplegin gene is responsible for an autosomal recessive form of hereditary spastic paraplegia. This gene is a candidate gene for other hereditary spastic paraplegias or neurodegenerative disorders. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 148 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | CLRLWGRGGCWPRGLQQLLVPGGVGPGEQPCLRTLYRFVT TQARASRNSLLTDIIAAYQRFCSRPPKGFGKYFPNGKN GKKASEPKEVMGEKKESKPAATTRSSGGGGGGGGKRGG KKDDSHWWSRFQKGDIPWDDKDFRMFFLWTALFWGGVMFYLLLKRSGRE |
| Gene Name | AFG3L2 AFG3 ATPase family gene 3-like 2 (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | AFG3L2 |
| Synonyms | AFG3L2; AFG3 ATPase family gene 3-like 2 (S. cerevisiae); AFG3 (ATPase family gene 3, yeast) like 2 , AFG3 ATPase family gene 3 like 2 (yeast) , SCA28, spinocerebellar ataxia 28; AFG3-like protein 2; |
| Gene ID | 10939 |
| mRNA Refseq | NM_006796 |
| Protein Refseq | NP_006787 |
| MIM | 604581 |
| Uniprot ID | Q9Y4W6 |
| Chromosome Location | 18p11.21 |
| Function | ATP binding; metal ion binding; metalloendopeptidase activity; nucleoside-triphosphatase activity; nucleotide binding; |
| ◆ Recombinant Proteins | ||
| AFG3L2-26445TH | Recombinant Human AFG3L2, His-tagged | +Inquiry |
| AFG3L2-5205H | Recombinant Human AFG3L2 protein, GST-tagged | +Inquiry |
| AFG3L2-409H | Recombinant Human AFG3L2 Protein, GST-tagged | +Inquiry |
| AFG3L2-9459H | Recombinant Human AFG3L2, His-tagged | +Inquiry |
| AFG3L2-1401M | Recombinant Mouse AFG3L2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AFG3L2-8987HCL | Recombinant Human AFG3L2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AFG3L2 Products
Required fields are marked with *
My Review for All AFG3L2 Products
Required fields are marked with *
