"AGR3" Related Products

Expand
Expand

Recombinant Human AGR3, His-tagged

Cat.No.: AGR3-26657TH
Product Overview: Recombinant full length Human AGR3 with N terminal His tag; 169 amino acids with tag, Predicted MWt 19.5 kDa.
Description: Anterior gradient protein 3 homolog is a protein that in humans is encoded by the AGR3 gene.
Protein length: 145 amino acids
Conjugation: HIS
Molecular Weight: 19.500kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSMIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSEL
Sequence Similarities: Belongs to the AGR family.
Gene Name: AGR3 anterior gradient 3 homolog (Xenopus laevis) [ Homo sapiens ]
Official Symbol: AGR3
Synonyms: AGR3; anterior gradient 3 homolog (Xenopus laevis); anterior gradient protein 3 homolog; BCMP11; breast cancer membrane protein 11; hAG 3; HAG3; PDIA18; protein disulfide isomerase family A; member 18;
Gene ID: 155465
mRNA Refseq: NM_176813
Protein Refseq: NP_789783
MIM: 609482
Uniprot ID: Q8TD06
Chromosome Location: 7p21.1
Function: alpha-dystroglycan binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.