"AGR3" Related Products

Expand
Expand

Recombinant Human AGR3, His-tagged

Cat.No. : AGR3-26657TH
Product Overview : Recombinant full length Human AGR3 with N terminal His tag; 169 amino acids with tag, Predicted MWt 19.5 kDa.
Description : Anterior gradient protein 3 homolog is a protein that in humans is encoded by the AGR3 gene.
Protein length : 145 amino acids
Conjugation : HIS
Molecular Weight : 19.500kDa inclusive of tags
Source : E. coli
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGSMIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSEL
Sequence Similarities : Belongs to the AGR family.
Gene Name : AGR3 anterior gradient 3 homolog (Xenopus laevis) [ Homo sapiens ]
Official Symbol : AGR3
Synonyms : AGR3; anterior gradient 3 homolog (Xenopus laevis); anterior gradient protein 3 homolog; BCMP11; breast cancer membrane protein 11; hAG 3; HAG3; PDIA18; protein disulfide isomerase family A; member 18;
Gene ID : 155465
mRNA Refseq : NM_176813
Protein Refseq : NP_789783
MIM : 609482
Uniprot ID : Q8TD06
Chromosome Location : 7p21.1
Function : alpha-dystroglycan binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.