"AGR3" Related Products

Expand
Expand

Recombinant Human AGR3, His-tagged

Cat.No.: AGR3-26657TH
Product Overview: Recombinant full length Human AGR3 with N terminal His tag; 169 amino acids with tag, Predicted MWt 19.5 kDa.
Description: Anterior gradient protein 3 homolog is a protein that in humans is encoded by the AGR3 gene.
Protein length: 145 amino acids
Conjugation: HIS
Molecular Weight: 19.500kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSMIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSEL
Sequence Similarities: Belongs to the AGR family.
Gene Name: AGR3 anterior gradient 3 homolog (Xenopus laevis) [ Homo sapiens ]
Official Symbol: AGR3
Synonyms: AGR3; anterior gradient 3 homolog (Xenopus laevis); anterior gradient protein 3 homolog; BCMP11; breast cancer membrane protein 11; hAG 3; HAG3; PDIA18; protein disulfide isomerase family A; member 18;
Gene ID: 155465
mRNA Refseq: NM_176813
Protein Refseq: NP_789783
MIM: 609482
Uniprot ID: Q8TD06
Chromosome Location: 7p21.1
Function: alpha-dystroglycan binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.