"AGRN" Related Products

Expand

Recombinant Human AGRN, His-tagged

Cat.No.: AGRN-26658TH
Product Overview: Recombinant fragment, corresponding to amino acids 1601-2045 of Human Agrin with a N terminal His tag; 52kDa.
Description: This gene encodes one of several proteins that are critical in the development of the neuromuscular junction (NMJ), as identified in mouse knock-out studies. The encoded protein contains several laminin G, Kazal type serine protease inhibitor, and epidermal growth factor domains. Additional post-translational modifications occur to add glycosaminoglycans and disulfide bonds. In one family with congenital myasthenic syndrome affecting limb-girdle muscles, a mutation in this gene was found.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitution with 127 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: APCRVLPEGGAQCECPLGREGTFCQTASGQDGSGPFLADF NGFSHLELRGLHTFARDLGEKMALEVVFLARGPSGLLL YNGQKTDGKGDFVSLALRDRRLEFRYDLGKGAAVIRSR EPVTLGAWTRVSLERNGRKGALRVGDGPRVLGESPVPHTV LNLKEPLYVGGAPDFSKLARAAAVSSGFDGAIQLVSLG GRQLLTPEHVLRQVDVTSFAGHPCTRASGHPCLNGASC VPREAAYVCLCPGGFSGPHCEKGLVEKSAGDVDTLAFDGRTFVEYLNAVTESEKALQSNHFELSLRTEATQGLVLWSG KATERADYVALAIVDGHLQLSYNLGSQPVVLRSTVPVN TNRWLRVVAHREQREGSLQVGNEAPVTGSSPLGATQLD TDGALWLGGLPELPVGPALPKAYGTGFVGCLRDVVVGRHP LHLLEDAVTKPELRPCPTP
Gene Name: AGRN agrin [ Homo sapiens ]
Official Symbol: AGRN
Synonyms: AGRN; agrin; AGRIN; agrin proteoglycan;
Gene ID: 375790
mRNA Refseq: NM_198576
Protein Refseq: NP_940978
MIM: 103320
Uniprot ID: O00468
Chromosome Location: 1p36.33
Pathway: Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; NCAM signaling for neurite out-growth, organism-specific biosystem;
Function: acetylcholine receptor regulator activity; laminin binding; protein binding; structural constituent of cytoskeleton;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.