"AGRN" Related Products

Expand

Recombinant Human AGRN, His-tagged

Cat.No. : AGRN-26658TH
Product Overview : Recombinant fragment, corresponding to amino acids 1601-2045 of Human Agrin with a N terminal His tag; 52kDa.
Description : This gene encodes one of several proteins that are critical in the development of the neuromuscular junction (NMJ), as identified in mouse knock-out studies. The encoded protein contains several laminin G, Kazal type serine protease inhibitor, and epidermal growth factor domains. Additional post-translational modifications occur to add glycosaminoglycans and disulfide bonds. In one family with congenital myasthenic syndrome affecting limb-girdle muscles, a mutation in this gene was found.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitution with 127 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : APCRVLPEGGAQCECPLGREGTFCQTASGQDGSGPFLADF NGFSHLELRGLHTFARDLGEKMALEVVFLARGPSGLLL YNGQKTDGKGDFVSLALRDRRLEFRYDLGKGAAVIRSR EPVTLGAWTRVSLERNGRKGALRVGDGPRVLGESPVPHTV LNLKEPLYVGGAPDFSKLARAAAVSSGFDGAIQLVSLG GRQLLTPEHVLRQVDVTSFAGHPCTRASGHPCLNGASC VPREAAYVCLCPGGFSGPHCEKGLVEKSAGDVDTLAFDGRTFVEYLNAVTESEKALQSNHFELSLRTEATQGLVLWSG KATERADYVALAIVDGHLQLSYNLGSQPVVLRSTVPVN TNRWLRVVAHREQREGSLQVGNEAPVTGSSPLGATQLD TDGALWLGGLPELPVGPALPKAYGTGFVGCLRDVVVGRHP LHLLEDAVTKPELRPCPTP
Gene Name : AGRN agrin [ Homo sapiens ]
Official Symbol : AGRN
Synonyms : AGRN; agrin; AGRIN; agrin proteoglycan;
Gene ID : 375790
mRNA Refseq : NM_198576
Protein Refseq : NP_940978
MIM : 103320
Uniprot ID : O00468
Chromosome Location : 1p36.33
Pathway : Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; NCAM signaling for neurite out-growth, organism-specific biosystem;
Function : acetylcholine receptor regulator activity; laminin binding; protein binding; structural constituent of cytoskeleton;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.