"AQP8" Related Products

Expand
Expand

Recombinant Human AQP8

Cat.No.: AQP8-26532TH
Product Overview: Recombinant full length Human Aquaporin 8 with N terminal proprietary tag; Predicted MWt 54.16 kDa.
Description: Aquaporin 8 (AQP8) is a water channel protein. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0).Aquaporin 8 mRNA is found in pancreas and colon but not other tissues.
Protein length: 255 amino acids
Molecular Weight: 54.160kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed only in pancreas and colon.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MCEPEFGNDKAREPSVGGRWRVSWYERFVQPCLVELLGSA LFIFIGCLSVIENGTDTGLLQPALAHGLALGLVIATLGNI SGGHFNPAVSLAAMLIGGLNLVMLLPYWVSQLLGGMLGAA LAKAVSPEERFWNASGAAFVTVQEQGQVAGALVAEIILTT LLALAVCMGAINEKTKGPLAPFSIGFAVTVDILAGGPVSG GCMNPARAFGPAVVANHWNFHWIYWLGPLLAGLLVGLLIR CFIGDGKTRLILKAR
Sequence Similarities: Belongs to the MIP/aquaporin (TC 1.A.8) family.
Gene Name: AQP8 aquaporin 8 [ Homo sapiens ]
Official Symbol: AQP8
Synonyms: AQP8; aquaporin 8; aquaporin-8;
Gene ID: 343
mRNA Refseq: NM_001169
Protein Refseq: NP_001160
MIM: 603750
Uniprot ID: O94778
Chromosome Location: 16p12
Pathway: Aquaporin-mediated transport, organism-specific biosystem; Bile secretion, organism-specific biosystem; Bile secretion, conserved biosystem; Passive Transport by Aquaporins, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem;
Function: transporter activity; water channel activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.