Recombinant Human AQP8
Cat.No. : | AQP8-26532TH |
Product Overview : | Recombinant full length Human Aquaporin 8 with N terminal proprietary tag; Predicted MWt 54.16 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Aquaporin 8 (AQP8) is a water channel protein. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0).Aquaporin 8 mRNA is found in pancreas and colon but not other tissues. |
Protein length : | 255 amino acids |
Molecular Weight : | 54.160kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Expressed only in pancreas and colon. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MCEPEFGNDKAREPSVGGRWRVSWYERFVQPCLVELLGSA LFIFIGCLSVIENGTDTGLLQPALAHGLALGLVIATLGNI SGGHFNPAVSLAAMLIGGLNLVMLLPYWVSQLLGGMLGAA LAKAVSPEERFWNASGAAFVTVQEQGQVAGALVAEIILTT LLALAVCMGAINEKTKGPLAPFSIGFAVTVDILAGGPVSG GCMNPARAFGPAVVANHWNFHWIYWLGPLLAGLLVGLLIR CFIGDGKTRLILKAR |
Sequence Similarities : | Belongs to the MIP/aquaporin (TC 1.A.8) family. |
Gene Name : | AQP8 aquaporin 8 [ Homo sapiens ] |
Official Symbol : | AQP8 |
Synonyms : | AQP8; aquaporin 8; aquaporin-8; |
Gene ID : | 343 |
mRNA Refseq : | NM_001169 |
Protein Refseq : | NP_001160 |
MIM : | 603750 |
Uniprot ID : | O94778 |
Chromosome Location : | 16p12 |
Pathway : | Aquaporin-mediated transport, organism-specific biosystem; Bile secretion, organism-specific biosystem; Bile secretion, conserved biosystem; Passive Transport by Aquaporins, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; |
Function : | transporter activity; water channel activity; |
Products Types
◆ Recombinant Protein | ||
AQP8-2490H | Recombinant Human AQP8 Protein, His (Fc)-Avi-tagged | +Inquiry |
AQP8-653M | Recombinant Mouse AQP8 Protein, His (Fc)-Avi-tagged | +Inquiry |
AQP8-736H | Recombinant Human AQP8 protein, GST-tagged | +Inquiry |
AQP8-8246H | Recombinant Human AQP8 protein, His & GST-tagged | +Inquiry |
Aqp8-3605R | Recombinant Rat Aqp8, His-tagged | +Inquiry |
◆ Lysates | ||
AQP8-34HCL | Recombinant Human AQP8 lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket