Recombinant Human AQP8
Cat.No. : | AQP8-26532TH |
Product Overview : | Recombinant full length Human Aquaporin 8 with N terminal proprietary tag; Predicted MWt 54.16 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 255 amino acids |
Description : | Aquaporin 8 (AQP8) is a water channel protein. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0).Aquaporin 8 mRNA is found in pancreas and colon but not other tissues. |
Molecular Weight : | 54.160kDa inclusive of tags |
Tissue specificity : | Expressed only in pancreas and colon. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MCEPEFGNDKAREPSVGGRWRVSWYERFVQPCLVELLGSA LFIFIGCLSVIENGTDTGLLQPALAHGLALGLVIATLGNI SGGHFNPAVSLAAMLIGGLNLVMLLPYWVSQLLGGMLGAA LAKAVSPEERFWNASGAAFVTVQEQGQVAGALVAEIILTT LLALAVCMGAINEKTKGPLAPFSIGFAVTVDILAGGPVSG GCMNPARAFGPAVVANHWNFHWIYWLGPLLAGLLVGLLIR CFIGDGKTRLILKAR |
Sequence Similarities : | Belongs to the MIP/aquaporin (TC 1.A.8) family. |
Gene Name | AQP8 aquaporin 8 [ Homo sapiens ] |
Official Symbol | AQP8 |
Synonyms | AQP8; aquaporin 8; aquaporin-8; |
Gene ID | 343 |
mRNA Refseq | NM_001169 |
Protein Refseq | NP_001160 |
MIM | 603750 |
Uniprot ID | O94778 |
Chromosome Location | 16p12 |
Pathway | Aquaporin-mediated transport, organism-specific biosystem; Bile secretion, organism-specific biosystem; Bile secretion, conserved biosystem; Passive Transport by Aquaporins, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; |
Function | transporter activity; water channel activity; |
◆ Recombinant Proteins | ||
RFL-34606RF | Recombinant Full Length Rat Aquaporin-8(Aqp8) Protein, His-Tagged | +Inquiry |
RFL-34772HF | Recombinant Full Length Human Aquaporin-8(Aqp8) Protein, His-Tagged | +Inquiry |
RFL7106NF | Recombinant Full Length Notomys Alexis Aquaporin-8(Aqp8) Protein, His-Tagged | +Inquiry |
AQP8-658H | Recombinant Human AQP8 | +Inquiry |
AQP8-27HF | Recombinant Full Length Human AQP8 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AQP8-34HCL | Recombinant Human AQP8 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AQP8 Products
Required fields are marked with *
My Review for All AQP8 Products
Required fields are marked with *