Recombinant Human AQP8
| Cat.No. : | AQP8-26532TH |
| Product Overview : | Recombinant full length Human Aquaporin 8 with N terminal proprietary tag; Predicted MWt 54.16 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 255 amino acids |
| Description : | Aquaporin 8 (AQP8) is a water channel protein. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0).Aquaporin 8 mRNA is found in pancreas and colon but not other tissues. |
| Molecular Weight : | 54.160kDa inclusive of tags |
| Tissue specificity : | Expressed only in pancreas and colon. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MCEPEFGNDKAREPSVGGRWRVSWYERFVQPCLVELLGSA LFIFIGCLSVIENGTDTGLLQPALAHGLALGLVIATLGNI SGGHFNPAVSLAAMLIGGLNLVMLLPYWVSQLLGGMLGAA LAKAVSPEERFWNASGAAFVTVQEQGQVAGALVAEIILTT LLALAVCMGAINEKTKGPLAPFSIGFAVTVDILAGGPVSG GCMNPARAFGPAVVANHWNFHWIYWLGPLLAGLLVGLLIR CFIGDGKTRLILKAR |
| Sequence Similarities : | Belongs to the MIP/aquaporin (TC 1.A.8) family. |
| Gene Name | AQP8 aquaporin 8 [ Homo sapiens ] |
| Official Symbol | AQP8 |
| Synonyms | AQP8; aquaporin 8; aquaporin-8; |
| Gene ID | 343 |
| mRNA Refseq | NM_001169 |
| Protein Refseq | NP_001160 |
| MIM | 603750 |
| Uniprot ID | O94778 |
| Chromosome Location | 16p12 |
| Pathway | Aquaporin-mediated transport, organism-specific biosystem; Bile secretion, organism-specific biosystem; Bile secretion, conserved biosystem; Passive Transport by Aquaporins, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; |
| Function | transporter activity; water channel activity; |
| ◆ Recombinant Proteins | ||
| RFL-34606RF | Recombinant Full Length Rat Aquaporin-8(Aqp8) Protein, His-Tagged | +Inquiry |
| AQP8-736H | Recombinant Human AQP8 protein, GST-tagged | +Inquiry |
| AQP8-653M | Recombinant Mouse AQP8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| AQP8-1827M | Recombinant Mouse AQP8 Protein | +Inquiry |
| AQP8-26532TH | Recombinant Human AQP8 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AQP8-34HCL | Recombinant Human AQP8 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AQP8 Products
Required fields are marked with *
My Review for All AQP8 Products
Required fields are marked with *
