Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human ARFIP2, His-tagged

Cat.No. : ARFIP2-27057TH
Product Overview : Recombinant fragment, corresponding to amino acids 1-261 of Human ARFIP2 with an N-terminal His Tag, approximately 30kDa
  • Specification
  • Gene Information
  • Related Products
Description : ARFIP2 is a ubiquitously expressed protein implicated in mediating cross talk between RAC and ARF small GTPases. It has been shown that ARFIP2 binds specifically to GTP-bound ARF1 and ARF6, but binds to Rac-GTP and Rac-GDP with similar affinities. The X-ray structure of arfaptin reveals an elongated, crescent-shaped dimer of 3-helix coiled-coils. Structures of arfaptin with Rac bound to either GDP or the slowly hydrolysable analog GMPPNP show that the switch regions adopt similar conformations in both complexes.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:reconstitution with 105 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDLQQVMV SGPNLNETSIVSGGYGGSGDGLIPTGSGRHPSHSTTPS GPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFG RGSRTVDLELELQIELLRETKRKYESVLQLGRALTAHLYS LLQTQHALGDAFADLSQKSPELQEEFGYNAETQKLLCK NGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAAR LEYDAYRTDLEELSLGPRDAGTRGRLESA
Gene Name : ARFIP2 ADP-ribosylation factor interacting protein 2 [ Homo sapiens ]
Official Symbol : ARFIP2
Synonyms : ARFIP2; ADP-ribosylation factor interacting protein 2; arfaptin-2; arfaptin 2; POR1;
Gene ID : 23647
mRNA Refseq : NM_001242854
Protein Refseq : NP_001229783
MIM : 601638
Uniprot ID : P53365
Chromosome Location : 11p15
Pathway : Arf1 pathway, organism-specific biosystem;
Function : GTP binding; GTP-dependent protein binding; GTP-dependent protein binding; Rac GTPase binding; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (28)

Ask a question
Is ARFIP2 involved in any immune response or inflammation-related processes? 11/09/2022

While ARFIP2's direct involvement in immune response or inflammation-related processes is not well established, its role in vesicle trafficking could potentially impact immune cell function or inflammation signaling. Additional studies are required to elucidate its specific contributions in these contexts.

Does ARFIP2 play a role in cell migration or invasion? 07/16/2022

ARFIP2 has been implicated in cell migration and invasion processes. It interacts with actin cytoskeleton regulators and clathrin adaptor proteins, suggesting its involvement in cell motility and invasion mechanisms. However, further studies are needed to fully understand its role in these processes.

Are there any known functional domains in ARFIP2? 05/07/2022

Yes, ARFIP2 contains multiple functional domains, including an N-terminal BAR (Bin/Amphiphysin/Rvs) domain and a C-terminal ARF-binding domain.

Are there any studies exploring the knockout or overexpression of ARFIP2 in model organisms? 03/31/2022

Yes, knockout and overexpression studies of ARFIP2 have been conducted in model organisms such as mice and yeast to investigate its role in membrane trafficking and cellular processes. These studies provide insights into the physiological functions of ARFIP2.

Can ARFIP2 play a role in cancer progression? 02/01/2022

There is limited information on the involvement of ARFIP2 in cancer progression. However, abnormal membrane trafficking and organelle dynamics, which ARFIP2 regulates, can potentially contribute to cancer development. Further research is needed to determine the impact of ARFIP2 in the context of cancer.

Are there any known post-translational modifications of ARFIP2? 09/14/2021

Yes, ARFIP2 can undergo post-translational modifications such as phosphorylation, ubiquitination, and sumoylation. These modifications can impact its localization, stability, and interactions with other proteins.

Can ARFIP2 mutations lead to any human diseases? 06/11/2021

There is currently no direct evidence linking ARFIP2 mutations to human diseases. However, considering its involvement in vesicle trafficking and organelle dynamics, it is possible that mutations or dysregulation of ARFIP2 could contribute to the pathogenesis of certain diseases. Further research is needed to explore this potential connection and identify any specific disease associations.

Are there any known inhibitors or activators of ARFIP2? 04/01/2021

Currently, there are no specific inhibitors or activators of ARFIP2 that have been identified. However, compounds that affect ARF GTPases or other proteins involved in the same pathways as ARFIP2 may indirectly modulate its activity.

Can ARFIP2 regulate transcytosis processes? 12/13/2020

Transcytosis is the process by which molecules are transported across cells from one side to another. While there is currently no direct evidence suggesting that ARFIP2 specifically regulates transcytosis, its involvement in vesicle trafficking and membrane dynamics could potentially modulate transcytosis processes. Further research is needed to determine the exact role of ARFIP2 in transcytosis.

Is ARFIP2 involved in any neurodegenerative disorders? 08/09/2020

Currently, there is no direct evidence linking ARFIP2 to neurodegenerative disorders such as Alzheimer's disease or Parkinson's disease. However, considering its role in vesicle trafficking and organelle dynamics, it is possible that deregulation of ARFIP2 could contribute to the pathology of these diseases. Further research is needed to explore this potential connection.

Are there any known binding partners of ARFIP2? 03/21/2020

Yes, ARFIP2 has several known binding partners. It interacts with ARF GTPases, clathrin adaptor proteins (such as AP-1 and AP-3), and RAB GTPases. ARFIP2 also associates with components of the actin cytoskeleton, such as actin, capping protein, and cortactin. Additionally, it interacts with proteins involved in vesicle fusion and organelle dynamics, including SNARE proteins and myosin motors.

Does ARFIP2 contribute to synaptic vesicle trafficking in neurons? 03/17/2020

The specific involvement of ARFIP2 in synaptic vesicle trafficking in neurons is not well established. However, as ARFIP2 is involved in general vesicle trafficking processes and interacts with proteins associated with synaptic vesicles, it is possible that ARFIP2 plays a role in synaptic vesicle dynamics. Further studies are required to elucidate its specific contributions in neuronal synapses.

What are the known functions of ARFIP2 in vesicle trafficking? 10/30/2019

ARFIP2 has multiple known functions in vesicle trafficking. It participates in vesicle budding processes by facilitating the recruitment of ARF GTPases and clathrin adaptor proteins. ARFIP2 is also involved in cargo sorting and vesicle formation at the Golgi apparatus and endosomes. Additionally, ARFIP2 interacts with SNARE proteins and actin cytoskeleton regulators to regulate membrane fusion events and actin-mediated vesicle movement.

Can mutations in the ARFIP2 gene lead to any genetic disorders? 09/15/2019

As of now, no genetic disorders have been directly associated with mutations in the ARFIP2 gene. However, further research is necessary to determine if any disease-related mutations or dysregulations of ARFIP2 exist.

Is ARFIP2 involved in any signaling pathways? 06/22/2019

ARFIP2 itself is not primarily involved in signaling pathways. However, its interactions with ARF GTPases can influence downstream signaling events associated with vesicle trafficking and organelle dynamics.

Is ARFIP2 involved in any specific cellular processes? 05/02/2019

Yes, ARFIP2 is involved in various cellular processes such as cargo sorting, vesicle formation, endocytosis, and membrane remodeling. Its functions are primarily associated with intracellular membrane trafficking and organelle dynamics.

Does ARFIP2 play a role in intracellular transport between different organelles? 10/09/2018

Yes, ARFIP2 is involved in intracellular transport between different organelles. It participates in vesicle trafficking pathways between the Golgi apparatus, endosomes, and the plasma membrane. ARFIP2 interacts with various components of these organelles' membrane trafficking machinery, helping to regulate cargo transport and vesicle budding.

Does ARFIP2 have any known binding partners besides ARF proteins? 06/28/2018

Yes, ARFIP2 can interact with other proteins involved in vesicle trafficking, such as clathrin adaptor proteins, RAB GTPases, and actin cytoskeleton regulators.

Can ARFIP2 interact with membrane receptors or transmembrane proteins? 05/07/2018

ARFIP2 primarily interacts with components of the intracellular membrane trafficking machinery, such as ARF GTPases, clathrin adaptor proteins, and RAB GTPases. While it may indirectly interact with membrane receptors or transmembrane proteins through its involvement in vesicle trafficking, direct interactions with these proteins have not been extensively studied.

Are there any known disease associations with ARFIP2? 04/01/2018

Currently, there is limited information on disease associations specifically related to ARFIP2. Further research is needed to determine if there are any disease implications associated with this protein.

Can ARFIP2 be targeted for therapeutic interventions? 01/14/2018

Due to the limited understanding of ARFIP2 and its potential disease associations, the therapeutic targeting of ARFIP2 has not been explored extensively. Further research is required to determine its therapeutic potential.

Does ARFIP2 have any known cellular roles? 01/10/2018

Yes, ARFIP2 plays a role in membrane trafficking, specifically in the early secretory pathway and endocytic pathway.

Are there any known alternative splicing variants of the ARFIP2 gene? 11/17/2017

Yes, alternative splicing of the ARFIP2 gene can generate multiple isoforms. These isoforms may have distinct functions or subcellular localizations, but their specific roles are still under investigation.

Is ARFIP2 expressed in all cell types? 09/27/2017

ARFIP2 is expressed in a wide range of cell types and tissues, suggesting its ubiquitous role in membrane trafficking across different cellular contexts.

What methods can be used to study the localization of ARFIP2 within cells? 03/17/2017

Immunofluorescence staining coupled with confocal microscopy or subcellular fractionation techniques can be used to study the localization of ARFIP2 within cells.

Is ARFIP2 involved in exocytosis? 11/26/2016

ARFIP2 primarily functions in endocytosis and intracellular membrane trafficking processes. Its role in exocytosis is less well established. However, as it regulates vesicle trafficking and organelle dynamics, it may indirectly contribute to specific aspects of exocytosis in certain cellular contexts.

Is ARFIP2 conserved across species? 04/23/2016

Yes, ARFIP2 is highly conserved among different species, indicating its importance in cellular processes.

Does ARFIP2 interact with other proteins? 01/07/2016

Yes, ARFIP2 interacts with various proteins involved in membrane trafficking, such as ARF GTPases. It also interacts with clathrin, a protein involved in endocytosis.

Customer Reviews (8)

Write a review
Reviews
02/27/2021

    This variety allows me to select the most appropriate option based on the specific requirements of my research.

    05/27/2020

      It has been extensively utilized in protein electron microscopy structure analysis, yielding exceptional outcomes.

      01/23/2020

        the manufacturer's commitment to quality control and rigorous testing guarantees the reliability and reproducibility of the ARFIP1 protein, which is essential for obtaining accurate and consistent results.

        10/26/2017

          Its exceptional sensitivity and specificity make it an ideal choice for quantitative protein detection and analysis.

          12/16/2016

            Its versatility and reliability make ARFIP2 an excellent option for researchers seeking top-notch performance in ELISA and protein electron microscopy structure analysis.

            10/25/2016

              With its remarkable quality, reliability, and the manufacturer's excellent technical support, I am confident that it will be an invaluable asset in driving my scientific inquiries forward and facilitating groundbreaking discoveries in my field.

              10/14/2016

                I am grateful for their dedication and commitment to ensuring the success of my experiments.

                07/27/2016

                  Their expertise in protein production and purification ensures the delivery of a high-quality product that consistently performs well in my experiments.

                  Ask a Question for All ARFIP2 Products

                  Required fields are marked with *

                  My Review for All ARFIP2 Products

                  Required fields are marked with *

                  0

                  Inquiry Basket

                  cartIcon
                  logo

                  FOLLOW US

                  Terms and Conditions        Privacy Policy

                  Copyright © 2024 Creative BioMart. All Rights Reserved.

                  Contact Us

                  • /

                  Stay Updated on the Latest Bioscience Trends