Recombinant Human ARFIP2, His-tagged
Cat.No. : | ARFIP2-27057TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1-261 of Human ARFIP2 with an N-terminal His Tag, approximately 30kDa |
- Specification
- Gene Information
- Related Products
Description : | ARFIP2 is a ubiquitously expressed protein implicated in mediating cross talk between RAC and ARF small GTPases. It has been shown that ARFIP2 binds specifically to GTP-bound ARF1 and ARF6, but binds to Rac-GTP and Rac-GDP with similar affinities. The X-ray structure of arfaptin reveals an elongated, crescent-shaped dimer of 3-helix coiled-coils. Structures of arfaptin with Rac bound to either GDP or the slowly hydrolysable analog GMPPNP show that the switch regions adopt similar conformations in both complexes. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:reconstitution with 105 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDLQQVMV SGPNLNETSIVSGGYGGSGDGLIPTGSGRHPSHSTTPS GPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFG RGSRTVDLELELQIELLRETKRKYESVLQLGRALTAHLYS LLQTQHALGDAFADLSQKSPELQEEFGYNAETQKLLCK NGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAAR LEYDAYRTDLEELSLGPRDAGTRGRLESA |
Gene Name : | ARFIP2 ADP-ribosylation factor interacting protein 2 [ Homo sapiens ] |
Official Symbol : | ARFIP2 |
Synonyms : | ARFIP2; ADP-ribosylation factor interacting protein 2; arfaptin-2; arfaptin 2; POR1; |
Gene ID : | 23647 |
mRNA Refseq : | NM_001242854 |
Protein Refseq : | NP_001229783 |
MIM : | 601638 |
Uniprot ID : | P53365 |
Chromosome Location : | 11p15 |
Pathway : | Arf1 pathway, organism-specific biosystem; |
Function : | GTP binding; GTP-dependent protein binding; GTP-dependent protein binding; Rac GTPase binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
Arfip2-1676M | Recombinant Mouse Arfip2 Protein, Myc/DDK-tagged | +Inquiry |
ARFIP2-667M | Recombinant Mouse ARFIP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARFIP2-414R | Recombinant Rat ARFIP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARFIP2-1849M | Recombinant Mouse ARFIP2 Protein | +Inquiry |
ARFIP2-156H | Recombinant Human ARFIP2 protein, T7-tagged | +Inquiry |
◆ Lysates | ||
ARFIP2-8749HCL | Recombinant Human ARFIP2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (28)
Ask a questionWhile ARFIP2's direct involvement in immune response or inflammation-related processes is not well established, its role in vesicle trafficking could potentially impact immune cell function or inflammation signaling. Additional studies are required to elucidate its specific contributions in these contexts.
ARFIP2 has been implicated in cell migration and invasion processes. It interacts with actin cytoskeleton regulators and clathrin adaptor proteins, suggesting its involvement in cell motility and invasion mechanisms. However, further studies are needed to fully understand its role in these processes.
Yes, ARFIP2 contains multiple functional domains, including an N-terminal BAR (Bin/Amphiphysin/Rvs) domain and a C-terminal ARF-binding domain.
Yes, knockout and overexpression studies of ARFIP2 have been conducted in model organisms such as mice and yeast to investigate its role in membrane trafficking and cellular processes. These studies provide insights into the physiological functions of ARFIP2.
There is limited information on the involvement of ARFIP2 in cancer progression. However, abnormal membrane trafficking and organelle dynamics, which ARFIP2 regulates, can potentially contribute to cancer development. Further research is needed to determine the impact of ARFIP2 in the context of cancer.
Yes, ARFIP2 can undergo post-translational modifications such as phosphorylation, ubiquitination, and sumoylation. These modifications can impact its localization, stability, and interactions with other proteins.
There is currently no direct evidence linking ARFIP2 mutations to human diseases. However, considering its involvement in vesicle trafficking and organelle dynamics, it is possible that mutations or dysregulation of ARFIP2 could contribute to the pathogenesis of certain diseases. Further research is needed to explore this potential connection and identify any specific disease associations.
Currently, there are no specific inhibitors or activators of ARFIP2 that have been identified. However, compounds that affect ARF GTPases or other proteins involved in the same pathways as ARFIP2 may indirectly modulate its activity.
Transcytosis is the process by which molecules are transported across cells from one side to another. While there is currently no direct evidence suggesting that ARFIP2 specifically regulates transcytosis, its involvement in vesicle trafficking and membrane dynamics could potentially modulate transcytosis processes. Further research is needed to determine the exact role of ARFIP2 in transcytosis.
Currently, there is no direct evidence linking ARFIP2 to neurodegenerative disorders such as Alzheimer's disease or Parkinson's disease. However, considering its role in vesicle trafficking and organelle dynamics, it is possible that deregulation of ARFIP2 could contribute to the pathology of these diseases. Further research is needed to explore this potential connection.
Yes, ARFIP2 has several known binding partners. It interacts with ARF GTPases, clathrin adaptor proteins (such as AP-1 and AP-3), and RAB GTPases. ARFIP2 also associates with components of the actin cytoskeleton, such as actin, capping protein, and cortactin. Additionally, it interacts with proteins involved in vesicle fusion and organelle dynamics, including SNARE proteins and myosin motors.
The specific involvement of ARFIP2 in synaptic vesicle trafficking in neurons is not well established. However, as ARFIP2 is involved in general vesicle trafficking processes and interacts with proteins associated with synaptic vesicles, it is possible that ARFIP2 plays a role in synaptic vesicle dynamics. Further studies are required to elucidate its specific contributions in neuronal synapses.
ARFIP2 has multiple known functions in vesicle trafficking. It participates in vesicle budding processes by facilitating the recruitment of ARF GTPases and clathrin adaptor proteins. ARFIP2 is also involved in cargo sorting and vesicle formation at the Golgi apparatus and endosomes. Additionally, ARFIP2 interacts with SNARE proteins and actin cytoskeleton regulators to regulate membrane fusion events and actin-mediated vesicle movement.
As of now, no genetic disorders have been directly associated with mutations in the ARFIP2 gene. However, further research is necessary to determine if any disease-related mutations or dysregulations of ARFIP2 exist.
ARFIP2 itself is not primarily involved in signaling pathways. However, its interactions with ARF GTPases can influence downstream signaling events associated with vesicle trafficking and organelle dynamics.
Yes, ARFIP2 is involved in various cellular processes such as cargo sorting, vesicle formation, endocytosis, and membrane remodeling. Its functions are primarily associated with intracellular membrane trafficking and organelle dynamics.
Yes, ARFIP2 is involved in intracellular transport between different organelles. It participates in vesicle trafficking pathways between the Golgi apparatus, endosomes, and the plasma membrane. ARFIP2 interacts with various components of these organelles' membrane trafficking machinery, helping to regulate cargo transport and vesicle budding.
Yes, ARFIP2 can interact with other proteins involved in vesicle trafficking, such as clathrin adaptor proteins, RAB GTPases, and actin cytoskeleton regulators.
ARFIP2 primarily interacts with components of the intracellular membrane trafficking machinery, such as ARF GTPases, clathrin adaptor proteins, and RAB GTPases. While it may indirectly interact with membrane receptors or transmembrane proteins through its involvement in vesicle trafficking, direct interactions with these proteins have not been extensively studied.
Currently, there is limited information on disease associations specifically related to ARFIP2. Further research is needed to determine if there are any disease implications associated with this protein.
Due to the limited understanding of ARFIP2 and its potential disease associations, the therapeutic targeting of ARFIP2 has not been explored extensively. Further research is required to determine its therapeutic potential.
Yes, ARFIP2 plays a role in membrane trafficking, specifically in the early secretory pathway and endocytic pathway.
Yes, alternative splicing of the ARFIP2 gene can generate multiple isoforms. These isoforms may have distinct functions or subcellular localizations, but their specific roles are still under investigation.
ARFIP2 is expressed in a wide range of cell types and tissues, suggesting its ubiquitous role in membrane trafficking across different cellular contexts.
Immunofluorescence staining coupled with confocal microscopy or subcellular fractionation techniques can be used to study the localization of ARFIP2 within cells.
ARFIP2 primarily functions in endocytosis and intracellular membrane trafficking processes. Its role in exocytosis is less well established. However, as it regulates vesicle trafficking and organelle dynamics, it may indirectly contribute to specific aspects of exocytosis in certain cellular contexts.
Yes, ARFIP2 is highly conserved among different species, indicating its importance in cellular processes.
Yes, ARFIP2 interacts with various proteins involved in membrane trafficking, such as ARF GTPases. It also interacts with clathrin, a protein involved in endocytosis.
Customer Reviews (8)
Write a reviewThis variety allows me to select the most appropriate option based on the specific requirements of my research.
It has been extensively utilized in protein electron microscopy structure analysis, yielding exceptional outcomes.
the manufacturer's commitment to quality control and rigorous testing guarantees the reliability and reproducibility of the ARFIP1 protein, which is essential for obtaining accurate and consistent results.
Its exceptional sensitivity and specificity make it an ideal choice for quantitative protein detection and analysis.
Its versatility and reliability make ARFIP2 an excellent option for researchers seeking top-notch performance in ELISA and protein electron microscopy structure analysis.
With its remarkable quality, reliability, and the manufacturer's excellent technical support, I am confident that it will be an invaluable asset in driving my scientific inquiries forward and facilitating groundbreaking discoveries in my field.
I am grateful for their dedication and commitment to ensuring the success of my experiments.
Their expertise in protein production and purification ensures the delivery of a high-quality product that consistently performs well in my experiments.
Ask a Question for All ARFIP2 Products
Required fields are marked with *
My Review for All ARFIP2 Products
Required fields are marked with *
Inquiry Basket