"ARFIP2" Related Products

Expand
Expand

Recombinant Human ARFIP2, His-tagged

Cat.No. : ARFIP2-27057TH
Product Overview : Recombinant fragment, corresponding to amino acids 1-261 of Human ARFIP2 with an N-terminal His Tag, approximately 30kDa
Description : ARFIP2 is a ubiquitously expressed protein implicated in mediating cross talk between RAC and ARF small GTPases. It has been shown that ARFIP2 binds specifically to GTP-bound ARF1 and ARF6, but binds to Rac-GTP and Rac-GDP with similar affinities. The X-ray structure of arfaptin reveals an elongated, crescent-shaped dimer of 3-helix coiled-coils. Structures of arfaptin with Rac bound to either GDP or the slowly hydrolysable analog GMPPNP show that the switch regions adopt similar conformations in both complexes.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:reconstitution with 105 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDLQQVMV SGPNLNETSIVSGGYGGSGDGLIPTGSGRHPSHSTTPS GPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFG RGSRTVDLELELQIELLRETKRKYESVLQLGRALTAHLYS LLQTQHALGDAFADLSQKSPELQEEFGYNAETQKLLCK NGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAAR LEYDAYRTDLEELSLGPRDAGTRGRLESA
Gene Name : ARFIP2 ADP-ribosylation factor interacting protein 2 [ Homo sapiens ]
Official Symbol : ARFIP2
Synonyms : ARFIP2; ADP-ribosylation factor interacting protein 2; arfaptin-2; arfaptin 2; POR1;
Gene ID : 23647
mRNA Refseq : NM_001242854
Protein Refseq : NP_001229783
MIM : 601638
Uniprot ID : P53365
Chromosome Location : 11p15
Pathway : Arf1 pathway, organism-specific biosystem;
Function : GTP binding; GTP-dependent protein binding; GTP-dependent protein binding; Rac GTPase binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.