Recombinant Human ARFIP2 protein, T7-tagged
| Cat.No. : | ARFIP2-156H | 
| Product Overview : | Recombinant human Arfaptin-2 (341aa, Isoform_II) fused with T7 Tag at N-terminal was expressed in E. coli. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | E.coli | 
| Tag : | T7 | 
| Protein Length : | 341 a.a. | 
| Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. | 
| AA Sequence : | MASMTGGQQMGRGEFMTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGD GLIPTGSGRHPSHSTTPSGPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFGRGSRTVDLELELQIELLRE TKRKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQEEFGYNAETQKLLCKNGETLLGAVNFFVSSI NTLVTKTMEDTLMTVKQYEAARLEYDAYRTDLEELSLGPRDAGTRGRLESAQATFQAHRDKYEKLRGDVAIKLKF LEENKIKVMHKQLLLFHNAVSAYFAGNQKQLEQTLQQFNIKLRPPGAEKPSWLEEQ | 
| Purity : | >90% by SDS-PAGE | 
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. | 
| Gene Name | ARFIP2 ADP-ribosylation factor interacting protein 2 [ Homo sapiens ] | 
| Official Symbol | ARFIP2 | 
| Synonyms | ARFIP2; ADP-ribosylation factor interacting protein 2; arfaptin-2; arfaptin 2; POR1; partner of RAC1 (arfaptin 2); FLJ18046; FLJ18697; FLJ99239; | 
| Gene ID | 23647 | 
| mRNA Refseq | NM_001242854 | 
| Protein Refseq | NP_001229783 | 
| MIM | 601638 | 
| UniProt ID | P53365 | 
| Chromosome Location | 11p15 | 
| Pathway | Arf1 pathway, organism-specific biosystem; | 
| Function | GTP binding; GTP-dependent protein binding; GTP-dependent protein binding; Rac GTPase binding; protein binding; protein domain specific binding; | 
| ◆ Recombinant Proteins | ||
| ARFIP2-758R | Recombinant Rat ARFIP2 Protein | +Inquiry | 
| ARFIP2-156H | Recombinant Human ARFIP2 protein, T7-tagged | +Inquiry | 
| ARFIP2-414R | Recombinant Rat ARFIP2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ARFIP2-1849M | Recombinant Mouse ARFIP2 Protein | +Inquiry | 
| ARFIP2-27057TH | Recombinant Human ARFIP2, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| ARFIP2-8749HCL | Recombinant Human ARFIP2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All ARFIP2 Products
Required fields are marked with *
My Review for All ARFIP2 Products
Required fields are marked with *
  
        
    
      
            