Recombinant Human ARFIP2 protein, T7-tagged
Cat.No. : | ARFIP2-156H |
Product Overview : | Recombinant human Arfaptin-2 (341aa, Isoform_II) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 341 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFMTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGD GLIPTGSGRHPSHSTTPSGPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFGRGSRTVDLELELQIELLRE TKRKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQEEFGYNAETQKLLCKNGETLLGAVNFFVSSI NTLVTKTMEDTLMTVKQYEAARLEYDAYRTDLEELSLGPRDAGTRGRLESAQATFQAHRDKYEKLRGDVAIKLKF LEENKIKVMHKQLLLFHNAVSAYFAGNQKQLEQTLQQFNIKLRPPGAEKPSWLEEQ |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | ARFIP2 ADP-ribosylation factor interacting protein 2 [ Homo sapiens ] |
Official Symbol | ARFIP2 |
Synonyms | ARFIP2; ADP-ribosylation factor interacting protein 2; arfaptin-2; arfaptin 2; POR1; partner of RAC1 (arfaptin 2); FLJ18046; FLJ18697; FLJ99239; |
Gene ID | 23647 |
mRNA Refseq | NM_001242854 |
Protein Refseq | NP_001229783 |
MIM | 601638 |
UniProt ID | P53365 |
Chromosome Location | 11p15 |
Pathway | Arf1 pathway, organism-specific biosystem; |
Function | GTP binding; GTP-dependent protein binding; GTP-dependent protein binding; Rac GTPase binding; protein binding; protein domain specific binding; |
◆ Recombinant Proteins | ||
ARFIP2-758R | Recombinant Rat ARFIP2 Protein | +Inquiry |
ARFIP2-156H | Recombinant Human ARFIP2 protein, T7-tagged | +Inquiry |
ARFIP2-414R | Recombinant Rat ARFIP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARFIP2-1849M | Recombinant Mouse ARFIP2 Protein | +Inquiry |
ARFIP2-27057TH | Recombinant Human ARFIP2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARFIP2-8749HCL | Recombinant Human ARFIP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARFIP2 Products
Required fields are marked with *
My Review for All ARFIP2 Products
Required fields are marked with *