Recombinant Human ARL15, His-tagged

• Cat.No.: ARL15-27188TH
• Product Overview: Recombinant full length Human ARL15 with N terminal His tag; 224 amino acids including tag, Predicted MWt 25 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 204 amino acids
• Conjugation: HIS
• Molecular Weight: 25.000kDa inclusive of tags
• Form: Liquid
• Purity: by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSDLRITEAFLYMDYLCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTGFSIKAVPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLEAARNELHSALQHPQLCTLPFLILANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDMDALKDSFSQLINLLEEKDHEAVRM
• Sequence Similarities: Belongs to the small GTPase superfamily. Arf family.

Gene Information

• Gene Name: ARL15 ADP-ribosylation factor-like 15 [ Homo sapiens ]
• Official Symbol: ARL15
• Synonyms: ARL15; ADP-ribosylation factor-like 15; ADP ribosylation factor related protein 2 , ARFRP2; ADP-ribosylation factor-like protein 15; FLJ20051
• Gene ID: 54622
• mRNA Refseq: NM_019087
• Protein Refseq: NP_061960
• Uniprot ID: Q9NXU5
• Chromosome Location: 5p15.2
• Function: GTP binding; nucleotide binding