"ARL15" Related Products

Expand

Recombinant Human ARL15, His-tagged

Cat.No.: ARL15-27188TH
Product Overview: Recombinant full length Human ARL15 with N terminal His tag; 224 amino acids including tag, Predicted MWt 25 kDa.
Protein length: 204 amino acids
Conjugation: HIS
Molecular Weight: 25.000kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSDLRITEAFLYMDYLCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTGFSIKAVPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLEAARNELHSALQHPQLCTLPFLILANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDMDALKDSFSQLINLLEEKDHEAVRM
Sequence Similarities: Belongs to the small GTPase superfamily. Arf family.
Gene Name: ARL15 ADP-ribosylation factor-like 15 [ Homo sapiens ]
Official Symbol: ARL15
Synonyms: ARL15; ADP-ribosylation factor-like 15; ADP ribosylation factor related protein 2 , ARFRP2; ADP-ribosylation factor-like protein 15; FLJ20051;
Gene ID: 54622
mRNA Refseq: NM_019087
Protein Refseq: NP_061960
Uniprot ID: Q9NXU5
Chromosome Location: 5p15.2
Function: GTP binding; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.