"ARL15" Related Products

Expand

Recombinant Human ARL15, His-tagged

Cat.No. : ARL15-27188TH
Product Overview : Recombinant full length Human ARL15 with N terminal His tag; 224 amino acids including tag, Predicted MWt 25 kDa.
Protein length : 204 amino acids
Conjugation : HIS
Molecular Weight : 25.000kDa inclusive of tags
Source : E. coli
Form : Liquid
Purity : by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMSDLRITEAFLYMDYLCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTGFSIKAVPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLEAARNELHSALQHPQLCTLPFLILANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDMDALKDSFSQLINLLEEKDHEAVRM
Sequence Similarities : Belongs to the small GTPase superfamily. Arf family.
Gene Name : ARL15 ADP-ribosylation factor-like 15 [ Homo sapiens ]
Official Symbol : ARL15
Synonyms : ARL15; ADP-ribosylation factor-like 15; ADP ribosylation factor related protein 2 , ARFRP2; ADP-ribosylation factor-like protein 15; FLJ20051;
Gene ID : 54622
mRNA Refseq : NM_019087
Protein Refseq : NP_061960
Uniprot ID : Q9NXU5
Chromosome Location : 5p15.2
Function : GTP binding; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.