Recombinant Human ARL15, His-tagged
Cat.No. : | ARL15-27188TH |
Product Overview : | Recombinant full length Human ARL15 with N terminal His tag; 224 amino acids including tag, Predicted MWt 25 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 204 amino acids |
Conjugation : | HIS |
Molecular Weight : | 25.000kDa inclusive of tags |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSDLRITEAFLYMDYLCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTGFSIKAVPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLEAARNELHSALQHPQLCTLPFLILANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDMDALKDSFSQLINLLEEKDHEAVRM |
Sequence Similarities : | Belongs to the small GTPase superfamily. Arf family. |
Gene Name | ARL15 ADP-ribosylation factor-like 15 [ Homo sapiens ] |
Official Symbol | ARL15 |
Synonyms | ARL15; ADP-ribosylation factor-like 15; ADP ribosylation factor related protein 2 , ARFRP2; ADP-ribosylation factor-like protein 15; FLJ20051; |
Gene ID | 54622 |
mRNA Refseq | NM_019087 |
Protein Refseq | NP_061960 |
Uniprot ID | Q9NXU5 |
Chromosome Location | 5p15.2 |
Function | GTP binding; nucleotide binding; |
◆ Recombinant Proteins | ||
ARL15-719M | Recombinant Mouse ARL15 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARL15-1209HF | Recombinant Full Length Human ARL15 Protein, GST-tagged | +Inquiry |
ARL15-6893H | Recombinant Human ADP-Ribosylation Factor-Like 15, His-tagged | +Inquiry |
ARL15-1926M | Recombinant Mouse ARL15 Protein | +Inquiry |
ARL15-9853H | Recombinant Human ARL15, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL15-8718HCL | Recombinant Human ARL15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL15 Products
Required fields are marked with *
My Review for All ARL15 Products
Required fields are marked with *