Recombinant Human ARL15 protein, GST-tagged
| Cat.No. : | ARL15-806H |
| Product Overview : | Human ARL15 full-length ORF ( NP_061960.1, 1 a.a. - 204 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ARL15 (ADP Ribosylation Factor Like GTPase 15) is a Protein Coding gene. GO annotations related to this gene include GTP binding. An important paralog of this gene is ARL8A. |
| Molecular Mass : | 49.3 kDa |
| AA Sequence : | MSDLRITEAFLYMDYLCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTGFSIKAVPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLEAARNELHSALQHPQLCTLPFLILANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDMDALKDSFSQLINLLEEKDHEAVRM |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ARL15 ADP-ribosylation factor-like 15 [ Homo sapiens ] |
| Official Symbol | ARL15 |
| Synonyms | ARL15; ADP-ribosylation factor-like 15; ADP ribosylation factor related protein 2 , ARFRP2; ADP-ribosylation factor-like protein 15; FLJ20051; ARF-related protein 2; ADP-ribosylation factor related protein 2; ADP-ribosylation factor-related protein 2; ARFRP2; |
| Gene ID | 54622 |
| mRNA Refseq | NM_019087 |
| Protein Refseq | NP_061960 |
| UniProt ID | Q9NXU5 |
| ◆ Recombinant Proteins | ||
| ARL15-1209HF | Recombinant Full Length Human ARL15 Protein, GST-tagged | +Inquiry |
| ARL15-399R | Recombinant Rhesus monkey ARL15 Protein, His-tagged | +Inquiry |
| ARL15-228R | Recombinant Rhesus Macaque ARL15 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ARL15-9853H | Recombinant Human ARL15, GST-tagged | +Inquiry |
| ARL15-1926M | Recombinant Mouse ARL15 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARL15-8718HCL | Recombinant Human ARL15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL15 Products
Required fields are marked with *
My Review for All ARL15 Products
Required fields are marked with *
