Recombinant Human ARL15 protein, GST-tagged

Cat.No. : ARL15-806H
Product Overview : Human ARL15 full-length ORF ( NP_061960.1, 1 a.a. - 204 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ARL15 (ADP Ribosylation Factor Like GTPase 15) is a Protein Coding gene. GO annotations related to this gene include GTP binding. An important paralog of this gene is ARL8A.
Molecular Mass : 49.3 kDa
AA Sequence : MSDLRITEAFLYMDYLCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTGFSIKAVPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLEAARNELHSALQHPQLCTLPFLILANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDMDALKDSFSQLINLLEEKDHEAVRM
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARL15 ADP-ribosylation factor-like 15 [ Homo sapiens ]
Official Symbol ARL15
Synonyms ARL15; ADP-ribosylation factor-like 15; ADP ribosylation factor related protein 2 , ARFRP2; ADP-ribosylation factor-like protein 15; FLJ20051; ARF-related protein 2; ADP-ribosylation factor related protein 2; ADP-ribosylation factor-related protein 2; ARFRP2;
Gene ID 54622
mRNA Refseq NM_019087
Protein Refseq NP_061960
UniProt ID Q9NXU5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARL15 Products

Required fields are marked with *

My Review for All ARL15 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon