Recombinant Human ARL15 protein, GST-tagged
Cat.No. : | ARL15-806H |
Product Overview : | Human ARL15 full-length ORF ( NP_061960.1, 1 a.a. - 204 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ARL15 (ADP Ribosylation Factor Like GTPase 15) is a Protein Coding gene. GO annotations related to this gene include GTP binding. An important paralog of this gene is ARL8A. |
Molecular Mass : | 49.3 kDa |
AA Sequence : | MSDLRITEAFLYMDYLCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTGFSIKAVPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLEAARNELHSALQHPQLCTLPFLILANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDMDALKDSFSQLINLLEEKDHEAVRM |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARL15 ADP-ribosylation factor-like 15 [ Homo sapiens ] |
Official Symbol | ARL15 |
Synonyms | ARL15; ADP-ribosylation factor-like 15; ADP ribosylation factor related protein 2 , ARFRP2; ADP-ribosylation factor-like protein 15; FLJ20051; ARF-related protein 2; ADP-ribosylation factor related protein 2; ADP-ribosylation factor-related protein 2; ARFRP2; |
Gene ID | 54622 |
mRNA Refseq | NM_019087 |
Protein Refseq | NP_061960 |
UniProt ID | Q9NXU5 |
◆ Recombinant Proteins | ||
ARL15-9853H | Recombinant Human ARL15, GST-tagged | +Inquiry |
ARL15-399R | Recombinant Rhesus monkey ARL15 Protein, His-tagged | +Inquiry |
ARL15-6893H | Recombinant Human ADP-Ribosylation Factor-Like 15, His-tagged | +Inquiry |
ARL15-719M | Recombinant Mouse ARL15 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARL15-1926M | Recombinant Mouse ARL15 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL15-8718HCL | Recombinant Human ARL15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARL15 Products
Required fields are marked with *
My Review for All ARL15 Products
Required fields are marked with *
0
Inquiry Basket