"ATP5D" Related Products

Expand
Expand
Expand

Recombinant Human ATP5D, His-tagged

Cat.No.: ATP5D-27063TH
Product Overview: Recombinant full length Human ATP5D with N terminal His tag; 167 amino acids including tag, MWt 17.3 kDa.
Description: This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the delta subunit of the catalytic core. Alternatively spliced transcript variants encoding the same isoform have been identified.
Protein length: 146 amino acids
Conjugation: HIS
Molecular Weight: 17.300kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, pH 8.0
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE
Sequence Similarities: Belongs to the ATPase epsilon chain family.
Gene Name: ATP5D ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit [ Homo sapiens ]
Official Symbol: ATP5D
Synonyms: ATP5D; ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit; ATP synthase subunit delta, mitochondrial;
Gene ID: 513
mRNA Refseq: NM_001001975
Protein Refseq: NP_001001975
MIM: 603150
Uniprot ID: P30049
Chromosome Location: 19p13.3
Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; F-type ATPase, eukaryotes, organism-specific biosystem; Formation of ATP by chemiosmotic coupling, organism-specific biosystem;
Function: contributes_to ADP binding; contributes_to ATP binding; contributes_to ATPase activity; hydrogen ion transporting ATP synthase activity, rotational mechanism; protein complex binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.