"BBOX1" Related Products

Expand
Expand

Recombinant Human BBOX1, His-tagged

Cat.No.: BBOX1-26648TH
Product Overview: Recombinant fragment, corresponding to amino acids 100-387 of Human BBOX1 with N terminal His tag; 288 amino acids, 34kDa.
Description: This gene encodes gamma butyrobetaine hydroxylase which catalyzes the formation of L-carnitine from gamma-butyrobetaine, the last step in the L-carnitine biosynthetic pathway. Carnitine is essential for the transport of activated fatty acids across the mitochondrial membrane during mitochondrial beta-oxidation.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 92 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: ARAKLQRELFFPECQYWGSELQLPTLDFEDVLRYDEHAYK WLSTLKKVGIVRLTGASDKPGEVSKLGKRMGFLYLTFY GHTWQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLL HCIKQTVTGGDSEIVDGFNVCQKLKKNNPQAFQILSST FVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNN ATRDTIFDVPVERVQPFYAALKEFVDLMNSKESKFTFKMN PGDVITFDNWRLLHGRRSYEAGTEISRHLEGAYADWDV VMSRLRILRQRVENGN
Gene Name: BBOX1 butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetaine hydroxylase) 1 [ Homo sapiens ]
Official Symbol: BBOX1
Synonyms: BBOX1; butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetaine hydroxylase) 1; BBOX; gamma-butyrobetaine dioxygenase; BBH; G BBH; gamma BBH;
Gene ID: 8424
mRNA Refseq: NM_003986
Protein Refseq: NP_003977
MIM: 603312
Uniprot ID: O75936
Chromosome Location: 11p
Pathway: Carnitine synthesis, organism-specific biosystem; Lysine degradation, organism-specific biosystem; Lysine degradation, conserved biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem;
Function: gamma-butyrobetaine dioxygenase activity; gamma-butyrobetaine dioxygenase activity; gamma-butyrobetaine dioxygenase activity; iron ion binding; metal ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.