Recombinant Human BBOX1, His-tagged
| Cat.No. : | BBOX1-26648TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 100-387 of Human BBOX1 with N terminal His tag; 288 amino acids, 34kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 100-387 a.a. |
| Description : | This gene encodes gamma butyrobetaine hydroxylase which catalyzes the formation of L-carnitine from gamma-butyrobetaine, the last step in the L-carnitine biosynthetic pathway. Carnitine is essential for the transport of activated fatty acids across the mitochondrial membrane during mitochondrial beta-oxidation. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 92 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | ARAKLQRELFFPECQYWGSELQLPTLDFEDVLRYDEHAYK WLSTLKKVGIVRLTGASDKPGEVSKLGKRMGFLYLTFY GHTWQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLL HCIKQTVTGGDSEIVDGFNVCQKLKKNNPQAFQILSST FVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNN ATRDTIFDVPVERVQPFYAALKEFVDLMNSKESKFTFKMN PGDVITFDNWRLLHGRRSYEAGTEISRHLEGAYADWDV VMSRLRILRQRVENGN |
| Gene Name | BBOX1 butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetaine hydroxylase) 1 [ Homo sapiens ] |
| Official Symbol | BBOX1 |
| Synonyms | BBOX1; butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetaine hydroxylase) 1; BBOX; gamma-butyrobetaine dioxygenase; BBH; G BBH; gamma BBH; |
| Gene ID | 8424 |
| mRNA Refseq | NM_003986 |
| Protein Refseq | NP_003977 |
| MIM | 603312 |
| Uniprot ID | O75936 |
| Chromosome Location | 11p |
| Pathway | Carnitine synthesis, organism-specific biosystem; Lysine degradation, organism-specific biosystem; Lysine degradation, conserved biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; |
| Function | gamma-butyrobetaine dioxygenase activity; gamma-butyrobetaine dioxygenase activity; gamma-butyrobetaine dioxygenase activity; iron ion binding; metal ion binding; |
| ◆ Recombinant Proteins | ||
| BBOX1-6335H | Recombinant Human BBOX1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| BBOX1-101H | Recombinant Human BBOX1 Protein, GST-tagged | +Inquiry |
| Bbox1-1828M | Recombinant Mouse Bbox1 Protein, Myc/DDK-tagged | +Inquiry |
| BBOX1-280H | Recombinant Human BBOX1, His-GST tagged | +Inquiry |
| BBOX1-1581HF | Recombinant Full Length Human BBOX1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BBOX1-001HCL | Recombinant Human BBOX1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BBOX1 Products
Required fields are marked with *
My Review for All BBOX1 Products
Required fields are marked with *
