Recombinant Human BBOX1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | BBOX1-6335H |
Product Overview : | BBOX1 MS Standard C13 and N15-labeled recombinant protein (NP_003977) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes gamma butyrobetaine hydroxylase which catalyzes the formation of L-carnitine from gamma-butyrobetaine, the last step in the L-carnitine biosynthetic pathway. Carnitine is essential for the transport of activated fatty acids across the mitochondrial membrane during mitochondrial beta-oxidation. |
Molecular Mass : | 44.7 kDa |
AA Sequence : | MACTIQKAEALDGAHLMQILWYDEEESLYPAVWLRDNCPCSDCYLDSAKARKLLVEALDVNIGIKGLIFDRKKVYITWPDEHYSEFQADWLKKRCFSKQARAKLQRELFFPECQYWGSELQLPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLTGASDKPGEVSKLGKRMGFLYLTFYGHTWQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCQKLKKNNPQAFQILSSTFVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNNATRDTIFDVPVERVQPFYAALKEFVDLMNSKESKFTFKMNPGDVITFDNWRLLHGRRSYEAGTEISRHLEGAYADWDVVMSRLRILRQRVENGNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | BBOX1 gamma-butyrobetaine hydroxylase 1 [ Homo sapiens (human) ] |
Official Symbol | BBOX1 |
Synonyms | BBOX1; butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetaine hydroxylase) 1; BBOX; gamma-butyrobetaine dioxygenase; BBH; G BBH; gamma BBH; gamma-butyrobetaine hydroxylase; gamma-butyrobetaine,2-oxoglutarate dioxygenase 1; G-BBH; gamma-BBH; |
Gene ID | 8424 |
mRNA Refseq | NM_003986 |
Protein Refseq | NP_003977 |
MIM | 603312 |
UniProt ID | O75936 |
◆ Recombinant Proteins | ||
BBOX1-605R | Recombinant Rat BBOX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BBOX1-102H | Recombinant Human BBOX1 Protein, GST-tagged | +Inquiry |
BBOX1-280H | Recombinant Human BBOX1, His-GST tagged | +Inquiry |
BBOX1-6335H | Recombinant Human BBOX1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BBOX1-947R | Recombinant Rat BBOX1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BBOX1-001HCL | Recombinant Human BBOX1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BBOX1 Products
Required fields are marked with *
My Review for All BBOX1 Products
Required fields are marked with *
0
Inquiry Basket