"BPNT1" Related Products

Expand
Expand
Expand

Recombinant Human BPNT1, His-tagged

Cat.No.: BPNT1-27671TH
Product Overview: Recombinant full length Human BPNT1 with an N terminal His tag; 344 amino acids with a predicted MWt 37.5 kDa including tag.
Description: BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntases physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity.
Protein length: 308 amino acids
Conjugation: HIS
Molecular Weight: 37.500kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMASSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLTIIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGFQLKEVPAGKHIITTTRSHSNKLVTDCVAAMNPDAVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVKHMNSAGVLATLRNYDYYASRVPESIKNALVP
Gene Name: BPNT1 3(2), 5-bisphosphate nucleotidase 1 [ Homo sapiens ]
Official Symbol: BPNT1
Synonyms: BPNT1; 3(2), 5-bisphosphate nucleotidase 1; 3(2),5-bisphosphate nucleotidase 1;
Gene ID: 10380
mRNA Refseq: NM_006085
Protein Refseq: NP_006076
MIM: 604053
Uniprot ID: O95861
Chromosome Location: 1q42
Pathway: Biological oxidations, organism-specific biosystem; Cytosolic sulfonation of small molecules, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Phase II conjugation, organism-specific biosystem;
Function: 3(2),5-bisphosphate nucleotidase activity; hydrolase activity; magnesium ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.