Recombinant Human BPNT1, His-tagged

• Cat.No.: BPNT1-27671TH
• Product Overview: Recombinant full length Human BPNT1 with an N terminal His tag; 344 amino acids with a predicted MWt 37.5 kDa including tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 308 amino acids
• Description: BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntases physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity.
• Conjugation: HIS
• Molecular Weight: 37.500kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMASSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLTIIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGFQLKEVPAGKHIITTTRSHSNKLVTDCVAAMNPDAVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVKHMNSAGVLATLRNYDYYASRVPESIKNALVP

Gene Information

• Gene Name: BPNT1 3(2), 5-bisphosphate nucleotidase 1 [ Homo sapiens ]
• Official Symbol: BPNT1
• Synonyms: BPNT1; 3(2), 5-bisphosphate nucleotidase 1; 3(2),5-bisphosphate nucleotidase 1
• Gene ID: 10380
• mRNA Refseq: NM_006085
• Protein Refseq: NP_006076
• MIM: 604053
• Uniprot ID: O95861
• Chromosome Location: 1q42
• Pathway: Biological oxidations, organism-specific biosystem; Cytosolic sulfonation of small molecules, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Phase II conjugation, organism-specific biosystem
• Function: 3(2),5-bisphosphate nucleotidase activity; hydrolase activity; magnesium ion binding