Recombinant Human BST2
Cat.No. : | BST2-26110TH |
Product Overview : | Recombinant fragment of Human BST2 with N terminal proprietary tag; Predicted MWt 41.25 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 141 amino acids |
Description : | Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis. |
Molecular Weight : | 41.250kDa inclusive of tags |
Tissue specificity : | Predominantly expressed in liver, lung, heart and placenta. Lower levels in pancreas, kidney, skeletal muscle and brain. Overexpressed in multiple myeloma cells. Highly expressed during B-cell development, from pro-B precursors to plasma cells. Highly exp |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PLIIFTIKANSEACRDGLRAVMECRNVTHLLQQELTEAQK GFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGE ITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQD SSSAAAPQLLIVLLGLSALLQ |
Sequence Similarities : | Belongs to the tetherin family. |
Gene Name | BST2 bone marrow stromal cell antigen 2 [ Homo sapiens ] |
Official Symbol | BST2 |
Synonyms | BST2; bone marrow stromal cell antigen 2; bone marrow stromal antigen 2; CD317; tetherin; |
Gene ID | 684 |
mRNA Refseq | NM_004335 |
Protein Refseq | NP_004326 |
MIM | 600534 |
Uniprot ID | Q10589 |
Chromosome Location | 19p13.2 |
Function | protein homodimerization activity; signal transducer activity; |
◆ Recombinant Proteins | ||
BST2-8583H | Recombinant Human BST2, His tagged | +Inquiry |
BST2-954M | Recombinant Mouse BST2 Protein, Fc-tagged | +Inquiry |
Bst2-1897M | Recombinant Mouse Bst2 Protein, Myc/DDK-tagged | +Inquiry |
BST2-683R | Recombinant Rat BST2 Protein, His (Fc)-Avi-tagged | +Inquiry |
BST2-39HF | Recombinant Full Length Human BST2 Protein | +Inquiry |
◆ Native Proteins | ||
BST2-18H | Active Recombinant Human BST2 Protein, Fc tagged | +Inquiry |
BST2-20H | Active Recombinant Human BST2 Protein, Fc tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
BST2-1623MCL | Recombinant Mouse BST2 cell lysate | +Inquiry |
BST2-1242HCL | Recombinant Human BST2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BST2 Products
Required fields are marked with *
My Review for All BST2 Products
Required fields are marked with *