Recombinant Human BST2
| Cat.No. : | BST2-26110TH |
| Product Overview : | Recombinant fragment of Human BST2 with N terminal proprietary tag; Predicted MWt 41.25 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 141 amino acids |
| Description : | Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis. |
| Molecular Weight : | 41.250kDa inclusive of tags |
| Tissue specificity : | Predominantly expressed in liver, lung, heart and placenta. Lower levels in pancreas, kidney, skeletal muscle and brain. Overexpressed in multiple myeloma cells. Highly expressed during B-cell development, from pro-B precursors to plasma cells. Highly exp |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | PLIIFTIKANSEACRDGLRAVMECRNVTHLLQQELTEAQK GFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGE ITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQD SSSAAAPQLLIVLLGLSALLQ |
| Sequence Similarities : | Belongs to the tetherin family. |
| Gene Name | BST2 bone marrow stromal cell antigen 2 [ Homo sapiens ] |
| Official Symbol | BST2 |
| Synonyms | BST2; bone marrow stromal cell antigen 2; bone marrow stromal antigen 2; CD317; tetherin; |
| Gene ID | 684 |
| mRNA Refseq | NM_004335 |
| Protein Refseq | NP_004326 |
| MIM | 600534 |
| Uniprot ID | Q10589 |
| Chromosome Location | 19p13.2 |
| Function | protein homodimerization activity; signal transducer activity; |
| ◆ Recombinant Proteins | ||
| BST2-2832H | Recombinant Human BST2 Protein, MYC/DDK-tagged | +Inquiry |
| BST2-3569H | Recombinant Human BST2, His-tagged | +Inquiry |
| BST2-18H | Active Recombinant Human BST2 Protein, Fc tagged | +Inquiry |
| BST2-954M | Recombinant Mouse BST2 Protein, Fc-tagged | +Inquiry |
| BST2-1598H | Recombinant Human BST2 Protein (Ser50-Ser161), N-Gst tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BST2-1242HCL | Recombinant Human BST2 cell lysate | +Inquiry |
| BST2-1623MCL | Recombinant Mouse BST2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BST2 Products
Required fields are marked with *
My Review for All BST2 Products
Required fields are marked with *



